BindingDB logo
APPROVED_DRUGS EXPERIMENTAL_DRUGS OTHER_COMPOUNDS PEPTIDES
 A  B  C  D  F  G  H  I  K  L  M  N  O  P  Q  R  S  T  V  W  Y
A Top
Ac-araevhlrks-nh2
Ac-artkqtarks-nh2
Ac-fvptdvgafaf
Ac-fvptnvgseaf
Ac-gsaraevhlrks-nh2
Ac-hsdavftdqytrlrkqvaakkylqsikqkryc
Ac-ptdvgafaf
Ac-raevhlrks-nh2
Ac-rpttlnl-oh
Ac-ryyrwkkkkkkk-nh2ZP120
Ac-saraevhlrks-nh2
Ac-sfllrdpqdk-nh2
Ac-shlglar-h
Ac-shlglar-pna
Ac-vpppvpprrr-nh2
Ac-vptdvgafaf
Ac-vthrlagllsrsggvvknnfvptdvgpfaf-nh2
Ac-vthrlagllsrsggvvrknfvptdvgpfaf-nh2
Ac-wriarleekvktlkaqnselastanmlreqvaqlkqkvcc-nh2
Ac-wvthqlagllsqsggvvrknfvptdvgpfaf-nh2
Ac-wvthrlagllsrsggvvrknfvptdvgpfaf-nh2
Ac-yrmehdfrwg-nh2
Ac-yrmehdfrwgsppkd-nh2
Acdtatcvthrlagllsrsggvvknnfvptnvgskaf-amide
Acdtatcvthrlagllsrsggvvknnfvptnvgskaf-nh2
Akkkkkc-taggg
Arrrrrc-taggg
Asp-brpmp-leu
Atwlppr
Awfwll-nh2
Azafvptdvgpfaf-nh2
Azapeptide
B Top
Bzlglyggftgarksark-nh2
Bzlglyggftgarksarklknq-nh2
C Top
C(rgdfmef)
C(rgdfmev)EMD-12192; EMD-121974; CILENGITIDE; cyclo(Arg-Gly-Asp-D-Phe-[N-Me]Val)
Cyclo(cyiqncplg)
Cyclo(cyiqncplgagagag
Cyclo(rgdfv) (control)
Cyclo[ghqmfyybta]-nh2
Cyclo[gldnkmifwybta]-nh2
Cyclo[rgdfk(cypate)]
D Top
Dcrsdtlcge-nh2
Dipeptide ligand
Dota-reccehdfrwckpv-nh2
Dota-reccehdfrwckpv-oh
Dota-reccehdfrwckpvd-oh
Dota-reccehdfrwcrpv-nh2
Dprwfwll-nh2
Dwfwll-nh2
F Top
Fllrdpqdk-nh2
Fv-aib-tdvgpfaf
Fv-hop-tdvgpfaf
Fv-hyp-tdvgpfaf
Fv-tic-tdvgpfaf
Fvptdvg-acp-faf
Fvptdvg-aib-faf
Fvptdvg-hyp-faf
Fvptdvg-pac-faf
G Top
Gpylpqtv-nh2
Gpyrmehfrwgsppkd-nh2
Gqvgrqlaiigddinr
Gwtlnsagyllgphav-nh2
Gwtlnsagyllgphavgnhrsfsdknglts-conh2
Gwtlnsagyllgpppalala-conh2
Gwtlnsagyllgpppgfspfr-conh2
Gwtlnsagyllgpqqffglm-conh2galantide
Gwtlnsagyllgprhyinlitrqry-conh2
Gwtlnsagyllgprpkpqqwfwll-conh2
H Top
H-ascdkcqlkg-nh2
H-fggftgarksark-nh2NC(1-13)NH2; FGGFTGARKSARK; N/OFQ(1-13)NH2
H-fggftgarksarkaanqa-nh2
H-fgipynpqsq-nh2
H-fihnfkrk-nh2
H-grwpvkt-nh2
H-hgqvdcspgiwqldcth-nh2
H-htdngsnf-nh2
H-smglpcvvm-oh
H-tayfllklagrw-nh2
H-vpppvpprrr-oh
H-vprrkaki-nh2
H-vyavtgrgdspa-nh2
H-wkgpakllwk-nh2
H2n-araevhlrks-nh2
H2n-artkqtarks-nh2
H2n-saraevhlrks-nh2
Haegtftsdvssylegqaakefiawlvkgrg-nh2
Hsdgtftselsrlqdsarlqrllqglv-nh2
Human neuropeptide y
Hwfwll-nh2
Hydroxyethylene dipeptide isostereL-682,679
I Top
Iacnckrhvikphicrkicgkn-nh2
Icvvqdwghhrct-nh2COMPSTATIN
Iii-btdNOCICEPTIN RECEPTOR ANTAGONIST PEPTIDE III-BTD
Ikcnckrhviaphicrkicgkn-nh2
Ikcnckrhvikahicrkicgkn-nh2
Ikcnckrhvikphicraicgkn-nh2
Ikcnckrhvikphicrkicgan-nh2
Ikcnckrhvikphicrkicgkn-nh2
Ilpwgwpwwpwpp-nh2
Ilpwgwpwwpwrr-nh2
Ilpwkwpwwpwp-nh2
Ilpwkwpwwpwpp-nh2
Ilpwkwpwwpwrr-nh2
K Top
Ksg-ldtknykqtsv
Kwfwll-nh2
L Top
L-brpmp-oh
Lpnynwnsfglrf-nh2
Lpnynwnsflrf-nh2
Lpwkwpwwpwpp-nh2
Lrhylnlltrqry-nh2
M Top
Macrocyclic tripeptide motif
N Top
N3-ghqmfyypra-nh2
N3-gldnkmifwypra-nh2
Ndp-sysmehfrwgkpvg
Neuropeptide y(npy)Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr; Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-OH
Neuropeptide-yneuropeptide Y; human Neuropeptide Y; Nucleopeptide Y(NPY)(YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY)
Ngyeiewyswvthgmy-nh2
O Top
Octadecapeptide venomApamin
P Top
Pentapeptide inhibitor 2
Peptide boronate
Phe-ggftgarksarklad-gluFGGFTGARKSARKLADE
Pkyvkqntlklat
Pmp lpqtvgp130 (904) derived peptide, 28
Pvkrrlf-nh2
Q Top
Qetayfllklagr-conh2
Qwfwll-nh2
R Top
Rpkpfqwfwll-nh2
Rwfwll-nh2
S Top
Sfllr-nh2P5-NH2; CAS_141923-41-3
Sfllrdpqd-nh2
Sfllrdpqdk-nh2
Sfllrdpqdk-oh
Sfllrdpqdkyepf-oh
Sfllrn-nh2CAS_141923-40-2
Sttvkaaswwa-conh2
T Top
Tasfllklagrw-nh2
Tayfllklagrl-nh2
Tetrapeptide inhibitor 1
Tpa lpqtvgp130 (904) derived peptide, 27
V Top
Vasoactive intestinal polypeptideCAS_37221-79-7
Vthrlagllsrsggvvknnfvptnvgskaf-nh2
W Top
Wfwgg-nh2
Wfwll-nh2
Wtlnsagyll-conh2
Wtlnsagyllgphavgnhpsfsdknglts-conh2
Wvthrlagllsrsggvvknnfvptnvgskaf-nh2
Y Top
Y lpqtvgp130 (904) derived peptide, 25
Y(p)apqtvgp130 (904) derived peptide, 20
Y(p)fkqncgp130 (813) derived peptide, 5
Y(p)hnqplEGFR (1086) derived peptide, 12
Y(p)inqsvEGFR (1068) derived peptide, 11
Y(p)kpqmhLIFR (1001) derived peptide, 9
Y(p)laqtvgp130 (904) derived peptide, 21
Y(p)lkqes
Y(p)lpatvgp130 (904) derived peptide, 22
Y(p)lpetvgp130 (904) derived peptide, 29
Y(p)lpntvgp130 (904) derived peptide, 30
Y(p)lpqavgp130 (904) derived peptide, 23
Y(p)lpqtagp130 (904) derived peptide, 24
Y(p)lrcdsGCSFR (748) derived peptide, 16
Y(p)qkqtr
Y(p)qpqakLIFR (981) derived peptide, 8
Y(p)rhqvpgp130 (767) derived peptide, 4
Y(p)rpqamLIFR (1028) derived peptide, 10
Y(p)sdgnfgp130 (673) derived peptide, 2
Y(p)stvvhgp130 (759) derived peptide, 3
Y(p)vlqgdGCSFR (708) derived peptide, 15
Yaga-vvndlNH2-YAGAVVNDL-COOH; Tyr-Ala-Gly-Ala-Val-Val-Asn-Asp-Leu; Tyr-D-Ala-Gly-Ala-Val-Val-Asn-Asp-Leu; H-Tyr-Ala-Gly-Ala-Val-Val-Asn-Asp-Leu-OH
Yfllkl-nh2
Ygrkkrrqrrr-klssiesdv