BindingDB logo
myBDB logout

Search by Compound Name


Compound Name:

Compounds Sorted by Binding Data per Compound

1   2   3   4   5   6   7   8   9   10   11   12   13   14   15   16   17   18   19   20   21   
22   23   24   25   26   27   28   29   30   31   32   33   34   35   36   37   38   39   40   41   42   
43   44   45   46   47   48   49   50   51   52   53   54   55   56   57   58   59   60   61   62   63   
64   65   66   67   68   69   70   71   72   73   74   75   76   77   78   79   80   81   82   83   84   
85   86   87   88   89   90   91   92   93   94   95   96   97   99   100   101   102   103   104   105   107   
108   109   110   111   112   113   114   115   116   118   119   121   122   123   124   125   126   127   128   130   131   
133   137   138   139   140   141   142   143   144   146   147   148   150   152   153   154   156   157   158   159   160   
162   163   164   165   168   169   171   172   173   174   177   183   185   186   188   190   196   198   199   203   206   
207   208   213   215   216   219   224   225   227   230   233   237   246   249   261   262   263   277   285   297   299   
303   308   311   317   326   330   333   335   336   337   344   359   360   379   389   391   413   442   443   444   445   
446   447   448   450   453   454   456   460   461   462   464   465   467   469   471   482   496   511   516   517   518   
529   531   539   559   571   583   790   804   818   821   824   831   839   841   848   849   851   853   859   869   876   
880   913   922   923   931   938   966   975   990   1015   1016   1018   1027   1058   1096   1125   1196   1381   1438   1490   1608   
Compounds Sorted Alphabetically
Compound Name
(alphabetical)
Enz. Inhib. DataITC DataBinding TargetsAlternate Compound Names
KiIC50KdEC50KoffKonOther
BDBM191598
PNG
040200000
  • Homo sapiens lysine demethylase 2A (KDM2A)
  • Lysine-specific demethylase 2B
  • Lysine-specific demethylase 3A
  • Lysine-specific demethylase 3B (KDM3B)
  • Lysine-specific demethylase 4A
  • Lysine-specific demethylase 4A (KDM4A)
  • Lysine-specific demethylase 4B
  • Lysine-specific demethylase 4C
  • Lysine-specific demethylase 5A
  • Lysine-specific demethylase 5A (KDM5A(1-1090)-Flag)
  • Lysine-specific demethylase 5A (KDM5A(1-588)ΔAP)
  • Lysine-specific demethylase 5A (KDM5A(1-739)ΔAP(2C-2S))
  • Lysine-specific demethylase 5A (KDM5A)
  • Lysine-specific demethylase 5B
  • Lysine-specific demethylase 5B (KDM5B(1-604)ΔAP)
  • Lysine-specific demethylase 5B (KDM5B(1-755)ΔAP)
  • Lysine-specific demethylase 5C
  • Lysine-specific demethylase 5C (KDM5C(1-789)ΔAP)
  • Lysine-specific demethylase 5C (KDM5C)
  • Lysine-specific demethylase 5D (KDM5D(1-760)ΔAP)
  • Lysine-specific demethylase 5D (KDM5D)
  • Lysine-specific demethylase 6A
  • Lysine-specific demethylase 6B
  • 2-(((2-((2-(dimethylamino)ethyl)(ethyl)amino)-2-oxoethyl)amino)methyl)isonicotinic acid (KDM5-C49)
  • KDM5-C49
  • KDOAM-20
BDBM23419
PNG
929300000
  • Aldose reductase (AR)
  • Amine oxidase [flavin-containing] A
  • Amine oxidase [flavin-containing] B
  • Butyrylcholinesterase (BChE)
  • Calmodulin
  • Carbonic anhydrase 1
  • Carbonic anhydrase 12
  • Carbonic anhydrase 2
  • Carbonic anhydrase 4
  • Carbonic anhydrase 7
  • Carbonyl reductase [NADPH] 1
  • Cholinesterases
  • Cytochrome P450 19A1
  • Cytochrome P450 1A
  • Cytochrome P450 1A1
  • Cytochrome P450 1B1
  • Estradiol 17-beta-dehydrogenase 1 (17beta-HSD1)
  • Estradiol 17-beta-dehydrogenase 2
  • Glyoxalase I
  • Human immunodeficiency virus type 1 integrase
  • Multidrug resistance protein 1/Multidrug resistance associated protein 1
  • P-glycoprotein (P-gp)
  • Pancreatic lipase
  • Protein-tyrosine phosphatase 1B
  • Testis-specific androgen-binding protein
  • Tyrosine-protein kinase receptor FLT3
  • Xanthine dehydrogenase/oxidase
  • alpha-Amylase
  • (2S)-5,7-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one
  • CHEMBL9352
  • Naringenin
BDBM24466
PNG
1428000000
  • Angiopoietin-1 receptor
  • Aurora kinase A
  • Aurora kinase B
  • Cyclin-Dependent Kinase 5 (CDK5)
  • Fibroblast growth factor receptor 1
  • Hepatocyte growth factor receptor
  • Insulin receptor
  • Insulin-like growth factor I receptor
  • Macrophage-stimulating protein receptor
  • Mast/stem cell growth factor receptor Kit
  • Mitogen-activated protein kinase 14
  • Mitogen-activated protein kinase 3
  • Mitogen-activated protein kinase 9
  • Proto-oncogene tyrosine-protein kinase Src
  • Proto-oncogene tyrosine-protein kinase receptor Ret
  • RAC-alpha serine/threonine-protein kinase AKT1
  • Ribosomal protein S6 kinase (P70S6K)
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase AKT2
  • Serine/threonine-protein kinase pim-1
  • Serine/threonine-protein kinase pim-2
  • Tyrosine Kinase c-Met
  • Tyrosine Kinase c-Met Mutant (D1228H)
  • Tyrosine Kinase c-Met Mutant (H1094R)
  • Tyrosine Kinase c-Met Mutant (M1250T)
  • Tyrosine Kinase c-Met Mutant (V1092I)
  • Tyrosine Kinase c-Met Mutant (Y1230H)
  • Tyrosine-protein kinase ABL1
  • Tyrosine-protein kinase BTK
  • Tyrosine-protein kinase JAK1
  • Tyrosine-protein kinase JAK2
  • Tyrosine-protein kinase JAK3
  • Tyrosine-protein kinase Lck
  • Vascular endothelial growth factor receptor 2
  • cAMP-dependent protein kinase (PKA)
  • 1-(2-hydroxy-2-methylpropyl)-N-{5-[(7-methoxyquinolin-4-yl)oxy]pyridin-2-yl}-5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazole-4-carboxamide
  • Substituted Pyrazolone, 17
BDBM25458
PNG
042000000
  • Bile salt export pump
  • Canalicular multispecific organic anion transporter 1
  • Canalicular multispecific organic anion transporter 2
  • Cytochrome P450 11B1, mitochondrial
  • Cytochrome P450 11B2 (CYP11B2)
  • Cytochrome P450 17A1
  • Cytochrome P450 19A1
  • Cytochrome P450 21A2
  • Cytochrome P450 3A
  • Multidrug resistance-associated protein 4
  • (1S,2R,5S,10R,11S,15S)-2,15-dimethyl-14-(pyridin-3-yl)tetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadeca-7,13-dien-5-ol
  • ABT
  • Abiraterone
  • CB 7598
  • CHEMBL254328
  • US9487554, Abiraterone
  • US9611270, Example 5, abiraterone
BDBM27135
PNG
234240000
  • Human diphtheria toxin-like ADP-ribosyltransferase (ARTD10 or PARP10)
  • Human diphtheria toxin-like ADP-ribosyltransferase (ARTD2 or PARP2)
  • Human diphtheria toxin-like ADP-ribosyltransferase (ARTD4 or PARP4)
  • Human diphtheria toxin-like ADP-ribosyltransferase (ARTD6 or PARP5b)
  • Human diphtheria toxin-like ADP-ribosyltransferase (ARTD8 or PARP14)
  • PARP 1, 2 and 3
  • Poly [ADP-ribose] polymerase 1
  • Poly [ADP-ribose] polymerase 12
  • Poly [ADP-ribose] polymerase 3
  • Tankyrase 1/2
  • 2-[(2R)-2-methylpyrrolidin-2-yl]-1H-1,3-benzodiazole-4-carboxamide
  • VELIPARIB
  • benzimidazole carboxamide, 3a
BDBM28701
PNG
330360000
  • Bile salt export pump
  • Bile salt export pump (BSEP)
  • Intestinal fatty acid-binding protein (hIFABP)
  • Liver fatty acid binding protein (rat L-FABP)
  • Organic anion-transporting polypeptide 1D1 (Oatp1d1)
  • Peroxisome proliferator-activated receptor
  • Peroxisome proliferator-activated receptor alpha
  • Peroxisome proliferator-activated receptor alpha (PPAR alpha)
  • Peroxisome proliferator-activated receptor delta
  • Peroxisome proliferator-activated receptor gamma
  • 2-(4-{2-[(4-chlorophenyl)formamido]ethyl}phenoxy)-2-methylpropanoic acid
  • Azufibrat
  • Bezafibrate
  • CHEMBL264374
  • Cedur
  • Sklerofibrat
BDBM35440
PNG
140100000
  • Dual Specificity Protein Phosphatase 1
  • MKP-3
  • Purine nucleoside phosphorylase
  • Xanthine dehydrogenase
  • Xanthine dehydrogenase/oxidase
  • ALLOPURINOL
  • MLS000069453
  • SMR000059083
  • cid_2094
BDBM50010594
PNG
2022000000
  • 5-hydroxytryptamine receptor 2A
  • D(2) dopamine receptor
  • D(3) dopamine receptor
  • DOPAMINE
  • Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
  • Dopamine receptor
  • Dopamine receptors; D2 & D4
  • Muscarinic acetylcholine receptor
  • Muscarinic acetylcholine receptor M1
  • Serotonin (5-HT) receptor
  • Serotonin 2 (5-HT2) receptor
  • Serotonin 3a (5-HT3a)/3b (5-HT3b) receptor
  • Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
  • 2-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine
  • 2-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine(isoclozapine)
  • CHEMBL415300
  • ISOCLOZAPINE
BDBM50015490
PNG
329010000
  • NPFF
  • NPFF2
  • NPY2R
  • NPY5R
  • Neuropeptide Y
  • Neuropeptide Y receptor type 1
  • Neuropeptide Y receptor type 2
  • Neuropeptide Y receptor type 5 ( NPY Y5)
  • Neuropeptide Y receptor type 5 (NPY Y5)
  • PPYR1
  • CHEMBL438945
  • H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
  • NPY
  • NPY, human
  • NPY, human, rat
  • Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY)
  • human Neuropeptide Y
BDBM50024294
PNG
043800000
  • AP2-associated protein kinase 1
  • Aurora kinase A
  • BMP-2-inducible protein kinase
  • CaM kinase I alpha
  • CaM kinase I delta
  • CaM kinase I gamma
  • CaM-kinase kinase beta
  • Casein kinase I
  • Casein kinase I delta/epsilon
  • Cyclin-dependent kinase 2
  • Death-associated protein kinase 2
  • Death-associated protein kinase 3
  • Dual specificity protein kinase CLK2
  • Dual specificity protein kinase CLK4
  • Dual specificity protein kinase TTK
  • Ephrin type-A receptor 3 (EPHA3)
  • MAP kinase-interacting serine/threonine-protein kinase 2
  • MAP/microtubule affinity-regulating kinase 2
  • Mitogen-activated protein kinase 10
  • Mitogen-activated protein kinase 9
  • Phosphorylase kinase
  • Ribosomal protein S6 kinase alpha 2
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase 17A
  • Serine/threonine-protein kinase 2
  • Serine/threonine-protein kinase 38-like
  • Serine/threonine-protein kinase 4 (STK4)
  • Serine/threonine-protein kinase Aurora-C
  • Serine/threonine-protein kinase GAK
  • Serine/threonine-protein kinase MST2
  • Serine/threonine-protein kinase PCTAIRE-1
  • Serine/threonine-protein kinase PLK4
  • Serine/threonine-protein kinase pim-2
  • TRAF2 and NCK-interacting protein kinase (TNIK)
  • Tyrosine-protein kinase STK16 (STK16)
  • ULK3 kinase
  • c-Jun N-terminal kinase, JNK
  • p38 delta/gamma
  • SP-600125
BDBM50035057
PNG
410100000
  • 5-HT3A Serotonin Receptor
  • Adrenergic receptor beta
  • Alpha-1A adrenergic receptor
  • Benzodiazepine central
  • Beta-1 adrenergic receptor
  • CCKBR
  • Calcium channel (DHP)
  • Calcium release-activated calcium channel
  • Cysteinyl leukotriene receptor 1
  • DOPAMINE
  • Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
  • Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
  • Glycine
  • HTR1D
  • HTR2C
  • Histamine H1 receptor
  • Ionotropic glutamate receptor NMDA 1/2D
  • Kappa-type opioid receptor
  • Muscarinic acetylcholine receptor M1
  • Muscarinic acetylcholine receptor M2
  • Muscarinic acetylcholine receptor M3
  • Nociceptin/mu opioid receptor
  • Opioid receptors; mu & delta
  • Serotonin (5-HT) receptor
  • Serotonin 1B/1D receptor
  • Sigma non-opioid intracellular receptor 1
  • Substance K
  • TRH
  • adrenergic Alpha2
  • (eltoprazine)1-(2,3-Dihydro-benzo[1,4]dioxin-5-yl)-piperazine
  • 1-(2,3-Dihydro-benzo[1,4]dioxin-5-yl)-piperazine
  • CHEMBL282614
  • Eltoprazine
BDBM50051293
PNG
2810400000
  • Bile salt export pump
  • Cannabinoid receptor 1/Mu-type opioid receptor
  • Cytochrome P450 1A
  • Cytochrome P450 2C19
  • Cytochrome P450 2C9
  • Cytochrome P450 2D6 (2D6)
  • Cytochrome P450 3A
  • Neurokinin 3 receptor
  • Neuromedin-K receptor
  • Substance-K receptor
  • Substance-P receptor
  • TACR3
  • (S)-(-)-N-(R-ethylbenzyl)-3-hydroxy-2-phenylquinoline-4-carboxamide
  • 3-Hydroxy-2-phenyl-quinoline-4-carboxylic acid ((S)-1-phenyl-propyl)-amide
  • 3-Hydroxy-2-phenyl-quinoline-4-carboxylic acid (1-phenyl-propyl)-amide
  • CHEMBL10188
  • SB 223412
  • SB-2234
  • SB-223412
  • Talnetant
BDBM50315213
PNG
042000000
  • Peptidyl-prolyl cis-trans isomerase FKBP1B/Serine/threonine-protein kinase mTOR
  • Phosphatidylinositol 3-kinase catalytic subunit type 3
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PI3K alpha)
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform/gamma isoform
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  • Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
  • Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  • Phosphoinositide 3-Kinase (PI3K), delta
  • Serine/threonine-protein kinase mTOR
  • 2-(difluoromethyl)-1-(4,6-dimorpholin-4-yl-1,3,5-triazin-2-yl)-1H-benzimidazole
  • 4,4'-(6-(2-(difluoromethyl)-1H-benzo[d]imidazol-1-yl)-1,3,5-triazine-2,4-diyl)dimorpholine
  • CHEMBL586702
  • TCMDC-137004
BDBM50366567
PNG
831300000
  • Bile salt export pump
  • Canalicular multispecific organic anion transporter 1
  • Canalicular multispecific organic anion transporter 2
  • Cytochrome P450 2D6 (2D6)
  • Krueppel-like factor 10
  • Monoamine transporters; Norepinephrine & serotonin
  • Monoamine transporters; Norepininephrine & dopamine
  • Multidrug resistance-associated protein 4
  • Norepinephrine Monoamine transporters
  • Potassium voltage-gated channel subfamily H member 2
  • Sodium-dependent dopamine transporter
  • Sodium-dependent noradrenaline transporter
  • Sodium-dependent serotonin transporter
  • Transporter
  • ATOMOXETINE
BDBM50413752
PNG
042000000
  • ALK tyrosine kinase receptor
  • Aurora kinase A
  • Cyclin-dependent kinase 2
  • Dual specificity mitogen-activated protein kinase kinase 2
  • Dual specificity mitogen-activated protein kinase kinase 6
  • Dual specificity mitogen-activated protein kinase kinase; MEK1/2
  • Ephrin receptor
  • Ephrin type-B receptor 4
  • Fibroblast growth factor receptor 3
  • Glycogen synthase kinase-3 beta
  • Hepatocyte growth factor receptor
  • Insulin receptor
  • Insulin-like growth factor I receptor
  • MAP kinase-activated protein kinase 5
  • Mast/stem cell growth factor receptor Kit
  • Mitogen-activated protein kinase 1
  • Mitogen-activated protein kinase 14
  • Non-receptor tyrosine-protein kinase TYK2
  • Protein kinase N1
  • Protein kinase N2
  • Proto-oncogene tyrosine-protein kinase receptor Ret
  • Pyruvate dehydrogenase kinase isoenzyme 1 (PDK1)
  • Receptor tyrosine-protein kinase erbB-2
  • Rho-associated protein kinase 2
  • Serine/threonine-protein kinase receptor R3
  • Tyrosine-protein kinase BTK
  • Tyrosine-protein kinase JAK1
  • Tyrosine-protein kinase JAK2
  • Tyrosine-protein kinase JAK3
  • Tyrosine-protein kinase Lck
  • Tyrosine-protein kinase ZAP-70
  • Tyrosine-protein kinase receptor FLT3
  • Tyrosine-protein kinase receptor UFO
  • Vascular endothelial growth factor receptor 2
  • Vascular endothelial growth factor receptor 3
  • cAMP-dependent protein kinase (PKA)
  • CHEMBL2012519
  • L-783277
BDBM7266
PNG
339000000
  • Casein kinase I isoform alpha
  • Casein kinase II alpha
  • Cyclin B/Cyclin-Dependent Kinase 1 (CDK1)/G2/mitotic-specific cyclin B2/G2/mitotic-specific cyclin B3
  • Cyclin-Dependent Kinase 1 (CDK1)
  • Cyclin-Dependent Kinase 2 (CDK2)
  • Cyclin-Dependent Kinase 5 (CDK5)
  • Cyclin-Dependent Kinase 9 (CDK9)
  • Cyclin-dependent kinase 1
  • Cyclin-dependent kinase 2
  • Dual specificty protein kinase CLK1
  • Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
  • Glycogen Synthase Kinase-3, beta
  • Glycogen synthase kinase 3
  • Glycogen synthase kinase-3 beta
  • Insulin receptor
  • Mitogen-activated protein kinase 1
  • Mitogen-activated protein kinase 3
  • NAD-dependent deacetylase sirtuin 2
  • Protein kinase Pfmrk
  • Proto-oncogene tyrosine-protein kinase Src
  • Serine/threonine-protein kinase PLK1
  • Steroidogenic Factor 1
  • Tyrosine-protein kinase Lck
  • Vascular endothelial growth factor receptor 2
  • nuclear receptor subfamily 0 group B member 1
  • 14-bromo-8,18-diazatetracyclo[9.7.0.0^{2,7}.0^{12,17}]octadeca-1(11),2,4,6,12(17),13,15-heptaen-9-one
  • 9-bromopaullone
  • CHEMBL296586
  • Kenpaullone
  • NSC 664704
  • Paullone Analog 5
  • cid_3820
BDBM8963
PNG
933000000
  • Acetylcholinesterase
  • Beta amyloid A4 protein
  • Beta-secretase 1
  • Butyrylcholinesterase (BChE)
  • Butyrylcholinesterase (BuChE)
  • Carboxylic ester hydrolase
  • Cholinesterases
  • CHEMBL32823
  • Homodimeric Tacrine Analog 3b
  • N-[7-(1,2,3,4-tetrahydroacridin-9-ylamino)heptyl]-1,2,3,4-tetrahydroacridin-9-amine
  • Tacrine Dimer 3b
  • Tacrine-Based Inhibitor 2f
  • tacrine homobivalent compound 3a