BindingDB logo
myBDB logout

Search by Compound Name


Compound Name:

Compounds Sorted by Binding Data per Compound

1   2   3   4   5   6   7   8   9   10   11   12   13   14   15   16   17   18   19   20   21   
22   23   24   25   26   27   28   29   30   31   32   33   34   35   36   37   38   39   40   41   42   
43   44   45   46   47   48   49   50   51   52   53   54   55   56   57   58   59   60   61   62   63   
64   65   66   67   68   69   70   71   72   73   74   75   76   77   78   79   80   81   82   83   84   
85   86   87   88   89   90   91   92   93   94   95   96   97   98   99   100   101   102   103   104   105   
108   109   110   111   112   113   114   116   117   118   119   120   122   123   124   125   126   127   128   129   130   
131   132   133   135   136   137   138   139   140   141   143   145   146   147   148   150   151   152   153   154   156   
157   158   159   160   162   164   165   168   169   170   171   173   178   183   186   188   190   194   195   202   203   
207   208   210   217   220   222   223   224   230   232   239   241   248   255   259   277   285   288   289   297   303   
304   306   308   310   329   330   333   335   336   337   355   360   364   381   389   411   442   443   444   445   446   
448   450   453   454   455   456   457   459   460   461   463   464   465   467   481   492   497   500   508   511   523   
527   536   538   581   730   790   804   821   824   829   831   832   836   838   847   848   853   855   864   865   880   
913   923   928   938   943   960   988   989   991   1004   1027   1046   1094   1125   1196   1336   1370   1421   1584   
Compounds Sorted Alphabetically
Compound Name
(alphabetical)
Enz. Inhib. DataITC DataBinding TargetsAlternate Compound Names
KiIC50KdEC50KoffKonOther
BDBM143750
PNG
420000000
  • Orexin receptor type 1
  • Orexin receptor type 1 (OX1)
  • Orexin receptor type 2
  • US10183953, Example 86
  • US8969352, 11
  • US8969352, 27
  • US9611277, Example 86
BDBM191598
PNG
040200000
  • Homo sapiens lysine demethylase 2A (KDM2A)
  • Homo sapiens lysine demethylase 2B (KDM2B)
  • Lysine-specific demethylase 3A
  • Lysine-specific demethylase 3B (KDM3B)
  • Lysine-specific demethylase 4A
  • Lysine-specific demethylase 4A (KDM4A)
  • Lysine-specific demethylase 4B
  • Lysine-specific demethylase 4C
  • Lysine-specific demethylase 5A
  • Lysine-specific demethylase 5A (KDM5A(1-1090)-Flag)
  • Lysine-specific demethylase 5A (KDM5A(1-588)ΔAP)
  • Lysine-specific demethylase 5A (KDM5A(1-739)ΔAP(2C-2S))
  • Lysine-specific demethylase 5A (KDM5A)
  • Lysine-specific demethylase 5B
  • Lysine-specific demethylase 5B (KDM5B(1-604)ΔAP)
  • Lysine-specific demethylase 5B (KDM5B(1-755)ΔAP)
  • Lysine-specific demethylase 5C
  • Lysine-specific demethylase 5C (KDM5C(1-789)ΔAP)
  • Lysine-specific demethylase 5C (KDM5C)
  • Lysine-specific demethylase 5D (KDM5D(1-760)ΔAP)
  • Lysine-specific demethylase 5D (KDM5D)
  • Lysine-specific demethylase 6A
  • Lysine-specific demethylase 6B
  • 2-(((2-((2-(dimethylamino)ethyl)(ethyl)amino)-2-oxoethyl)amino)methyl)isonicotinic acid (KDM5-C49)
  • KDM5-C49
  • KDOAM-20
BDBM22567
PNG
2414310000
  • 5-hydroxytryptamine receptor 1A (5-HT1A)
  • Adenosine receptor A3
  • HRH3
  • Histamine H1 receptor
  • Histamine H4 receptor
  • Histamine receptor (H3)
  • Voltage-gated potassium channel
  • 3H]pyrilamine
  • CHEMBL511
  • Dorantamin
  • MEPYRAMINE
  • Mepyramine
  • N-(4-methoxybenzyl)-N ,N -dimethyl-N-pyridin-2-ylethane-1,2-diamine
  • N-[2-(dimethylamino)ethyl]-N-[(4-methoxyphenyl)methyl]pyridin-2-amine
  • PYRILAMINE
  • Pyranisamine
  • [3H]mepyramine
  • [3H]pyrilamine
BDBM24466
PNG
1428000000
  • Aurora kinase A
  • Aurora kinase B
  • Cyclin-Dependent Kinase 5 (CDK5)
  • Fibroblast growth factor receptor 1
  • Hepatocyte growth factor receptor
  • Insulin receptor
  • Insulin-like growth factor I receptor
  • Macrophage-stimulating protein receptor
  • Mast/stem cell growth factor receptor Kit
  • Mitogen-activated protein kinase 14
  • Mitogen-activated protein kinase 3
  • Mitogen-activated protein kinase 9
  • Proto-oncogene tyrosine-protein kinase Src
  • Proto-oncogene tyrosine-protein kinase receptor Ret
  • RAC-alpha serine/threonine-protein kinase AKT1
  • Ribosomal protein S6 kinase (P70S6K)
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase AKT2
  • Serine/threonine-protein kinase PIM
  • Serine/threonine-protein kinase pim-2
  • Tyrosine Kinase c-Met
  • Tyrosine Kinase c-Met Mutant (D1228H)
  • Tyrosine Kinase c-Met Mutant (H1094R)
  • Tyrosine Kinase c-Met Mutant (M1250T)
  • Tyrosine Kinase c-Met Mutant (V1092I)
  • Tyrosine Kinase c-Met Mutant (Y1230H)
  • Tyrosine-protein kinase ABL1
  • Tyrosine-protein kinase BTK
  • Tyrosine-protein kinase JAK1
  • Tyrosine-protein kinase JAK2
  • Tyrosine-protein kinase JAK3
  • Tyrosine-protein kinase Lck
  • Vascular endothelial growth factor receptor 2
  • Vascular endothelial growth factor receptor 2 and tyrosine-protein kinase TIE-2 (KDR and TIE2)
  • cAMP-dependent protein kinase (PKA)
  • 1-(2-hydroxy-2-methylpropyl)-N-{5-[(7-methoxyquinolin-4-yl)oxy]pyridin-2-yl}-5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazole-4-carboxamide
  • Substituted Pyrazolone, 17
BDBM26983
PNG
400000000
  • Alpha carbonic anhydrase
  • Astrosclerin-3
  • Carbonic Anhydrase VA
  • Carbonic Anhydrase XIII
  • Carbonic Anhydrase XV
  • Carbonic anhydrase
  • Carbonic anhydrase 1
  • Carbonic anhydrase 2
  • Carbonic anhydrase 4
  • Carbonic anhydrase 6 (CA-VI)
  • Carbonic anhydrase 7
  • Carbonic anhydrase 9
  • Gamma-carbonic anhydrase
  • CHEMBL1644028
  • SCN(-1)
  • Thiocyanate
  • cyanosulfanide
  • sodium thiocyanate
  • thiocyanate
BDBM35440
PNG
140100000
  • Dual Specificity Protein Phosphatase 1
  • MKP-3
  • Purine nucleoside phosphorylase
  • Xanthine dehydrogenase
  • Xanthine dehydrogenase/oxidase
  • ALLOPURINOL
  • MLS000069453
  • SMR000059083
  • cid_2094
BDBM35938
PNG
2517000000
  • 5-hydroxytryptamine receptor 2C
  • Adrenaline alpha1
  • Adrenaline alpha2
  • Chloroquine resistance transporter
  • HRH3
  • Histamine H1 receptor
  • Histamine H4 receptor
  • Lethal(3)malignant brain tumor-like protein 1 (L3MBTL1)
  • Lethal(3)malignant brain tumor-like protein 3 (L3MBTL3)
  • Lethal(3)malignant brain tumor-like protein 4
  • MBT domain-containing protein 1 (MBTD1)
  • Muscarinic receptor M2 and M3
  • Platelet activating factor receptor
  • Serotonin receptor (2b and 2c)
  • Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
  • Sodium channel protein type I I alpha subunit
  • Voltage-gated potassium channel
  • 1-(p-chlorophenyl)-1-(2-pyridyl)-3-N,N-dimethylpropylamine
  • 1-(p-chlorophenyl)-1-(2-pyridyl)-3-dimethylaminopropane
  • 3-(p-chlorophenyl)-3-(2-pyridyl)-N,N-dimethylpropylamine
  • 5-HT,N-ACETYL
  • CHEMBL505
  • CHLORPHENIRAMINE
  • CHLORPHENIRAMINE MALEATE
  • Polaramin
  • Polaramine
  • Polaronil
  • [3H]Chlorphenamine
  • [3H]Chlorpheniramine
  • chlorophenylpyridamine
  • chlorphenamine
  • clorfeniramina
  • d-Chlorpheniramine
  • gamma-(4-chlorophenyl)-N,N-dimethyl-2-pyridinepropanamine
  • gamma-(4-chlorophenyl)-gamma-(2-pyridyl)propyldimethylamine
BDBM50001028
PNG
365010000
  • DRD1
  • DRD2
  • Delta-type opioid receptor
  • Glutamate-NMDA
  • HTR3A
  • Imidazoline I1
  • Kappa-type opioid receptor
  • Mu-type opioid receptor
  • Nociceptin/mu opioid receptor
  • OPIATE Sigma
  • OPRD1
  • Opioid receptor
  • Sigma non-opioid intracellular receptor 1
  • Vesicular acetylcholine transporter
  • mu/kappa opioid receptor
  • (+)-PENTAZOCINE
  • (-)-pentazocine
  • (2R,6R,11R)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol
  • (6R,11S)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol
  • 6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol
  • 6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol(Pentazocine)
  • CHEMBL560
  • PENTAZOCINE (+)
  • PENTAZOCINE (-)
  • Pentazocine
  • Pentazocine,(+/-)
  • Talacen
  • Talwin
  • US9656961, Example 00125
  • rel-(2R,6R,11R)-6,11-Dimethyl-3-(3-methyl-but-2-enyl)-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol
BDBM50010594
PNG
2022000000
  • 5-hydroxytryptamine receptor 2A
  • D(2) dopamine receptor
  • D(3) dopamine receptor
  • DOPAMINE
  • Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
  • Dopamine receptor
  • Dopamine receptors; D2 & D4
  • Muscarinic acetylcholine receptor
  • Muscarinic acetylcholine receptor M1
  • Serotonin (5-HT) receptor
  • Serotonin 2 (5-HT2) receptor
  • Serotonin 3a (5-HT3a)/3b (5-HT3b) receptor
  • Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
  • 2-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine
  • 2-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine(isoclozapine)
  • CHEMBL415300
  • ISOCLOZAPINE
BDBM50015490
PNG
329010000
  • NPFF
  • NPFF2
  • NPY2R
  • NPY5R
  • Neuropeptide Y
  • Neuropeptide Y receptor type 1
  • Neuropeptide Y receptor type 2
  • Neuropeptide Y receptor type 5 ( NPY Y5)
  • Neuropeptide Y receptor type 5 (NPY Y5)
  • PPYR1
  • CHEMBL438945
  • H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
  • NPY
  • NPY, human
  • NPY, human, rat
  • Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY)
  • human Neuropeptide Y
BDBM50024294
PNG
043800000
  • AP2-associated protein kinase 1
  • Aurora kinase A
  • BMP-2-inducible protein kinase
  • CaM kinase I alpha
  • CaM kinase I delta
  • CaM kinase I gamma
  • CaM-kinase kinase beta
  • Casein kinase I
  • Casein kinase I delta/epsilon
  • Cyclin-dependent kinase 2
  • Death-associated protein kinase 2
  • Death-associated protein kinase 3
  • Dual specificity protein kinase CLK2
  • Dual specificity protein kinase CLK4
  • Dual specificity protein kinase TTK
  • Ephrin type-A receptor 3 (EPHA3)
  • MAP kinase-interacting serine/threonine-protein kinase 2
  • MAP/microtubule affinity-regulating kinase 2
  • Mitogen-activated protein kinase 10
  • Mitogen-activated protein kinase 9
  • Phosphorylase kinase
  • Ribosomal protein S6 kinase alpha 2
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase 17A
  • Serine/threonine-protein kinase 2
  • Serine/threonine-protein kinase 38-like
  • Serine/threonine-protein kinase 4 (STK4)
  • Serine/threonine-protein kinase Aurora-C
  • Serine/threonine-protein kinase GAK
  • Serine/threonine-protein kinase MST2
  • Serine/threonine-protein kinase PCTAIRE-1
  • Serine/threonine-protein kinase PLK4
  • Serine/threonine-protein kinase pim-2
  • TRAF2 and NCK-interacting protein kinase (TNIK)
  • Tyrosine-protein kinase STK16 (STK16)
  • ULK3 kinase
  • c-Jun N-terminal kinase, JNK
  • p38 delta/gamma
  • SP-600125
BDBM50028421
PNG
402000000
  • 5-hydroxytryptamine receptor 1A (5-HT1A)
  • 5-hydroxytryptamine receptor 1B
  • 5-hydroxytryptamine receptor 1D
  • 5-hydroxytryptamine receptor 2A
  • 5-hydroxytryptamine receptor 2C
  • Adrenergic alpha1B
  • Alpha-1A adrenergic receptor
  • Alpha-1D adrenergic receptor
  • Alpha-2A adrenergic receptor
  • Alpha-2B adrenergic receptor
  • Alpha-2C adrenergic receptor
  • Beta-1 adrenergic receptor
  • Beta-2 adrenergic receptor and beta-3 adrenergic receptor
  • D(1A) dopamine receptor
  • D(2) dopamine receptor
  • D(3) dopamine receptor
  • DOPAMINE
  • Dopamine D1 receptor
  • Dopamine D2 receptor
  • Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
  • Dopamine D5 receptor
  • Dopamine receptor
  • Dopamine receptors; D2 & D4
  • HTR6
  • HTR7
  • Histamine H1 receptor
  • Serotonin (5-HT) receptor
  • Serotonin receptor (2b and 2c)
  • 9-Methylsulfanylmethyl-7-propyl-4,6,6a,7,8,9,10,10a-octahydro-indolo[4,3-fg]quinoline; compound with methanesulfonic acid
  • CHEMBL1275
  • LY-127809
  • PERGOLIDE MESYLATE
  • Pergolide
  • Permax
BDBM50035057
PNG
410100000
  • 5-HT3A Serotonin Receptor
  • Adrenergic receptor beta
  • Alpha-1A adrenergic receptor
  • Benzodiazepine central
  • Beta-1 adrenergic receptor
  • CCKBR
  • Calcium channel (DHP)
  • Calcium release-activated calcium channel
  • Cysteinyl leukotriene receptor 1
  • DOPAMINE
  • Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
  • Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
  • Glutamate-NMDA
  • Glycine
  • HTR1D
  • HTR2C
  • Histamine H1 receptor
  • Muscarinic acetylcholine receptor M1
  • Muscarinic receptor M2 and M3
  • Nociceptin/mu opioid receptor
  • OPIATE Sigma
  • Opioid receptor
  • Opioid receptors; mu & delta
  • Serotonin (5-HT) receptor
  • Serotonin 1B/1D receptor
  • Substance K
  • TRH
  • adrenergic Alpha2
  • (eltoprazine)1-(2,3-Dihydro-benzo[1,4]dioxin-5-yl)-piperazine
  • 1-(2,3-Dihydro-benzo[1,4]dioxin-5-yl)-piperazine
  • CHEMBL282614
  • Eltoprazine
BDBM50043280
PNG
5220150000
  • AGTR1
  • Angiotensin II AT1B
  • Angiotensin II receptor
  • Cytochrome P450 1A
  • Cytochrome P450 2C19
  • Cytochrome P450 2C9
  • Cytochrome P450 2D6 (2D6)
  • Cytochrome P450 2J2
  • Cytochrome P450 3A
  • Glycine
  • Multidrug and toxin extrusion protein 1
  • PPAR alpha/gamma
  • Peroxisome proliferator-activated receptor
  • Peroxisome proliferator-activated receptor alpha
  • Peroxisome proliferator-activated receptor alpha (PPAR alpha)
  • Peroxisome proliferator-activated receptor delta
  • Peroxisome proliferator-activated receptor delta (PPAR delta)
  • Peroxisome proliferator-activated receptor gamma
  • Solute carrier organic anion transporter family member 1B1 (OATP1B1)
  • Solute carrier organic anion transporter family member 1B3 (OATP1B3)
  • 4'-((1,4'-dimethyl-2'-propyl(2,6'-bi-1H-benzimidazol)-1'-yl)methyl)-(1,1'-biphenyl)-2-carboxylic acid
  • 4'-((4-methyl-6-(1-methyl-2-benzimidazolyl)-2-propyl-1-benzimidazolyl)methyl)-2-biphenylcarboxylic acid
  • 4'-[(1,4'-dimethyl-2'propyl[2,6'-bi-1H-benzimidazol]-1'-yl)methyl]-[1,1'-biphenyl]-2-carboxylic acid
  • 4'-[(1,7'-dimethyl-2'-propyl-1H,3'H-2,5'-bibenzimidazol-3'-yl)methyl][1,1'-biphenyl]-2-carboxylic acid
  • 4'-[(1,7'-dimethyl-2'-propyl-1H,3'H-2,5'-bibenzimidazol-3'-yl)methyl]biphenyl-2-carboxylic acid
  • BIBR 277
  • CHEMBL1017
  • TELMISARTAN
BDBM50315213
PNG
042000000
  • Phosphatidylinositol 3-kinase catalytic subunit type 3
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PI3K alpha)
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  • Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  • Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
  • Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  • Phosphoinositide 3-Kinase (PI3K), delta
  • Serine/threonine-protein kinase mTOR
  • 2-(difluoromethyl)-1-(4,6-dimorpholin-4-yl-1,3,5-triazin-2-yl)-1H-benzimidazole
  • 4,4'-(6-(2-(difluoromethyl)-1H-benzo[d]imidazol-1-yl)-1,3,5-triazine-2,4-diyl)dimorpholine
  • CHEMBL586702
  • TCMDC-137004