Compile Data Set for Download or QSAR
maximum 50k data

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB (change energy unit to kcal/mol)

Found 21 hits in this display   

TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1nMAssay Description:Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1nMAssay Description:Inhibition of human ADAMTS4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetMacrophage metalloelastase(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  9nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMacrophage metalloelastase(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  9nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  15nMAssay Description:Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetADAM metallopeptidase with thrombospondin type 1 motif, 5(Rattus norvegicus (Rat))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  15nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetNeutrophil collagenase(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  17.9nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  183nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCollagenase 3(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCollagenase 3(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1.11E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
Target72 kDa type IV collagenase(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1.75E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
Target72 kDa type IV collagenase(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1.80E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetStromelysin-1(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  2.80E+3nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetStromelysin-1(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  2.85E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetMatrix metalloproteinase-14(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  3.89E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetMatrix metalloproteinase-14(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  3.90E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMatrix metalloproteinase-9(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50:  1.20E+4nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetMatrilysin(Homo sapiens (Human))
Eli Lilly

US Patent
LigandPNGBDBM194638(US9206139, 1)
Affinity DataIC50: >1.00E+5nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent