Compile Data Set for Download or QSAR
maximum 50k data

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB (change energy unit to kcal/mol)

Found 337 hits in this display   

TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  310nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  374nMAssay Description:Inhibition of human PLK2 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  630nMAssay Description:Inhibition of human NEK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  1.83E+3nMAssay Description:Inhibition of human NEK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  4.42E+3nMAssay Description:Inhibition of human NEK5 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human GSK3alpha using [YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human RSK1 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TNIK using [RLGRDKYKTLRQIRQ] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TRKA using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FLT3 using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TSSK3 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FGFR1 using [KKKSPGEYVNIEFG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human EPHA6 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek9(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human NEK9 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FGFR3 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK4 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK1 using ERK2 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK2 using ERK2 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK3 using p38alpha as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK3 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMaternal embryonic leucine zipper kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MELK using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMisshapen-like kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MINK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MKK4More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MKK6 using p38alpha as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase, smooth muscle(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MLCK using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 2, skeletal/cardiac muscle(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MLCK2 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 9(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MLK1 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 10(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MLK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 11(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MLK3 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-interacting serine/threonine-protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MNK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-interacting serine/threonine-protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MNK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MRCKalpha using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK beta(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MRCKbeta using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MSK1 using [GRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MSK2 using [GRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MSSK1 using [GRSRSRSRSR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MST1 using [KKSRGDYMTMQIG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MST2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 24(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MST3 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 26(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MST4 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMuscle, skeletal receptor tyrosine-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MUSK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MYLK3 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin-IIIb(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MYO3b using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek11(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human NEK11 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human NEK3 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human NEK4 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human NEK6 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek7(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human NEK7 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase NLK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human NLK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase OSR1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human OSR1 using [RRHYYYDTHTNTYYLRTFGHNTRR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human P38alpha using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 11(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human P38beta using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 13(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human P38delta using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 12(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human P38gamma using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RPS6KB1 using [KKRNRTLTK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase beta-2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RPS6KB2 using [KKRNRTLTK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PAK1 using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PAK2 using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PAK3 using [KKLNRTLSFAEPG] substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PAK4 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PAK5 using [KKLNRTLSFAEPG] substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PAK 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PAK6 using [KKLNRTLSFAEPG] substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPAS domain-containing serine/threonine-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PASK using [KKLNRTLSFAEPG] substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLymphokine-activated killer T-cell-originated protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PBK using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PDGFRalpha using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlatelet-derived growth factor receptor beta(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PDGFRbeta using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PDK1 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PHKg1 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphorylase b kinase gamma catalytic chain, liver/testis isoform(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PHKg2 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PIM1 using [KKRNRTLTK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PIM2 using [RSRHSSYPAGT] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase pim-3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PIM3 using [RSRHSSYPAGT] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit beta(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKAcbeta using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit gamma(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKAcgamma using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCalpha using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C-binding protein 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCb1 using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C beta type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCb2 using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C delta type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCdelta using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C epsilon type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCepsilon using [ERMRPRKRQGSVRRRV] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C eta type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCeta using [ERMRPRKRQGSVRRRV] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ULK3 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase VRK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human VRK1 using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase VRK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human VRK2 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetWee1-like protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human WEE1 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase WNK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human WNK1 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase WNK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human WNK2 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase WNK3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human WNK3 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Yes(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human YES using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 20(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ZAK using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ZAP-70(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ZAP70 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ZIPK using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human recombinant PLK1 using recombinant dephosphorylated bovine alpha- casein/synuclein as substrate after 30 mins by scintillation co...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human recombinant PLK3 using recombinant dephosphorylated bovine alpha- casein/synuclein as substrate after 30 mins by scintillation co...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human recombinant PLK4 using recombinant dephosphorylated bovine alpha- casein/synuclein as substrate after 30 mins by scintillation co...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ABL1 using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ABL2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ABL2 using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetActivated CDC42 kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ACK1 using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human AKT1 using [KGSGSGRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-beta serine/threonine-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human AKT2 using [KGSGSGRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-gamma serine/threonine-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human AKT3 using [KGSGSGRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ALK using [KGSGSGRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase receptor R3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ALK1 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-1A(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ALK3 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ALK5 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase A-Raf(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ARAF using MEK1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ARK5 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ASK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK5/p25 using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK5/p35 using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK6/cyclin D1 using RB-CTF as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK6/cyclin D3 using RP protein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK7/cyclin H using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK9/cyclin K using [[protein fragment, 39 aa]] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CHK1 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CHK2 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CK1alpha1 using [KRRRAL[pS]VASLPGL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform delta(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CK1delta using [KRRRAL[pS]VASLPGL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform epsilon(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CK1epsilon using [KRRRAL[pS]VASLPGL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CK1gamma1 using [KRRRAL[pS]VASLPGL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CK1gamma2 using [KRRRAL[pS]VASLPGL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase I isoform gamma-3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CK1gamma3 using [KRRRAL[pS]VASLPGL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase II subunit alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CK2alpha using as [RRRDDDSDDD] substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCasein kinase II subunit alpha'(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CK2alpha2 using as [RRRDDDSDDD] substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CLK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CLK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CLK3 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity protein kinase CLK4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CLK4 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 8(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human COT1 using MEK1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase CSK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CSK using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMegakaryocyte-associated tyrosine-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CTK using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DAPK1 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDeath-associated protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DAPK2 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DCAMKL1 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase DCLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DCAMKL2 using [KKALRRQETVDAL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpithelial discoidin domain-containing receptor 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DDR1 using [KKSRGDYMTMQIG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDiscoidin domain-containing receptor 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DDR2 using [KKSRGDYMTMQIG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 12(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DLK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyotonin-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DMPK using [KKSRGDYMTMQIG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MRCK gamma(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DMPK2 using [KKRPQRRYSNVF] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 17A(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DRAK1 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1A(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DYRK1 using [RRRFRPASPLRGPPK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 1B(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DYRK1B using [RRRFRPASPLRGPPK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DYRK2 using [RRRFRPASPLRGPPK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DYRK3 using [RRRFRPASPLRGPPK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity tyrosine-phosphorylation-regulated kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human DYRK4 using [RRRFRPASPLRGPPK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EGFR using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA1 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA2 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA3 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA4 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA5 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 7(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 8(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHA8 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHB1 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHB2 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHB3 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-B receptor 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human EPHB4 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ERBB2 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ERBB4 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ERK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ERK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 7(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ERK5 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 15(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ERK7 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFocal adhesion kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FAK using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fer(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FER using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fes/Fps(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FES using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FGFR2 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FGFR4 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fgr(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FGR using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FLT1 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FLT4 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage colony-stimulating factor 1 receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FMS using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase FRK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FRK using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Fyn(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human FYN using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GCK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GLK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRhodopsin kinase GRK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GRK1 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBeta-adrenergic receptor kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GRK2 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBeta-adrenergic receptor kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GRK3 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GRK4 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GRK5 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG protein-coupled receptor kinase 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GRK6 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRhodopsin kinase GRK7(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human GRK7 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase haspin(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human Haspin using histone H3 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase HCK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human HCK using [KVEKIGEGTYGVVYK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human HGK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human HIPK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human HIPK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human HIPK3 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHomeodomain-interacting protein kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human HIPK4 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human HPK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human IGF1R using [KKKSPGEYVNIEFG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human IKKalpha using [KKKKERLLDDRHDSGLDSMKDEE] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit beta(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human IKKbeta using [KKKKERLLDDRHDSGLDSMKDEE] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInhibitor of nuclear factor kappa-B kinase subunit epsilon(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human IKKepsilon using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human IR using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human IRAK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInterleukin-1 receptor-associated kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human IRAK4 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetInsulin receptor-related protein(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human IRR using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase ITK/TSK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ITK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human JAK1 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human JAK2 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human JAK3 using [GEEEEYFELVKKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 8(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human JNK1 using ATF2 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 9(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human JNK2 using ATF2 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 10(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human JNK3 using ATF2 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human KDR using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human KHS using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LATS1 using [KKRNRRLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase LATS2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LATS2 using [KKRNRRLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lck(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LCK using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ICK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LCK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LIMK1 using cofilin as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLIM domain kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LIMK2 using cofilin as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase STK11(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LKB1 using [LSNLYHQGKFLQTFCGSPLYRRR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 10(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LOK using [RLGRDKYKTLRQIRQ] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeucine-rich repeat serine/threonine-protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LRRK2 using [RLGRDKYKTLRQIRQ] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LYN using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Lyn(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human LYN B using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MAPKAPK2 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C gamma type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCgamma using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C iota type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCiota using [ERMRPRKRQGSVRRRV] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCmu using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCnu using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C theta type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCtheta using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein kinase C zeta type(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKCzeta using [ERMRPRKRQGSVRRRV] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase D2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKD2 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKG1alpha using [LRRASLG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-dependent protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKG1beta using [LRRASLG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKN1 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKN2 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase N3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PKN3 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PLK1 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PLK3 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PLK4 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcAMP-dependent protein kinase catalytic subunit PRKX(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PRKX using [LRRASLG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 2-beta(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human PYK2 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAF proto-oncogene serine/threonine-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RAF1 using MEK1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase receptor Ret(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RET using [KKKSPGEYVNIEFG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RIPK2 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-interacting serine/threonine-protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RIPK3 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual serine/threonine and tyrosine protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RIPK5 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ROCK1 using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ROCK2 using [KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMacrophage-stimulating protein receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RON using [KKSRGDYMTMQIG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ROS using [KKKSPGEYVNIEFG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RSK2 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RSK3 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human RSK4 using [KEAKEKRQEQIAKRRRLSLRASTSKSGGSQK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SGK1 using [KGSGSGRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SGK2 using [KGSGSGRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Sgk3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SGK3 using [GRPRTSSFAEG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SIK1 using [AMARAASAAALARRR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SIK2 using [AMARAASAAALARRR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase SIK3 [59-1321](Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SIK3 using [AMARAASAAALARRR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20-like serine/threonine-protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SLK using histone H3 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNUAK family SNF1-like kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SNARK using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Srms(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SRMS using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SRPK1 using [GRSRSRSRSR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSRSF protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SRPK2 using [GRSRSRSRSR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SSTK using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 16(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK16 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK22D using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 25(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK25 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32B(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK32B using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 32C(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK32C using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 33(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK33 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK38 using [KKRNRRLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase 38-like(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK38L using [KKRNRRLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSTE20/SPS1-related proline-alanine-rich protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human STK39 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase SYK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human SYK using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 7(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TAK1 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TAOK1 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TAOK2 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TAO3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TAOK3 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase TBK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TBK1 using [KRRRAL[pS]VASLPGL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Tec(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TEC using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity testis-specific protein kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TESK1 using cofilin as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TGFBR2 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAngiopoietin-1 receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TIE2 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TLK1 using histone H3 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase tousled-like 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TLK2 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TNK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TNK1 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TRKB using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNT-3 growth factor receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TRKC using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TSSK2 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTau-tubulin kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TTBK1 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTau-tubulin kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TTBK2 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase TXK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TXK using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetLeukocyte tyrosine kinase receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TYK1 using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TYK2 using [KKSRGDYMTMQIG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor TYRO3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TYRO3 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ULK1 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ULK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human ULK2 using MBP substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase A(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human Aurora A using [H-LRRASLG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase B(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human Aurora B using [H-LRRASLG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAurora kinase C(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human Aurora C using [H-LRRASLG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human AXL using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Blk(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human BLK using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBone morphogenetic protein receptor type-2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human BMPR2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCytoplasmic tyrosine-protein kinase BMX(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human BMX using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase B-raf(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human BRAF using MEK1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein-tyrosine kinase 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human BRK using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human BRSK1 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase BRSK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human BRSK2 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human BTK using [KVEKIGEGTYGVVYK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMast/stem cell growth factor receptor Kit(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human c-Kit using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase Mer(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human c-MER using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHepatocyte growth factor receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human c-MET using [KKKSPGEYVNIEFG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProto-oncogene tyrosine-protein kinase Src(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human c-Src using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK1alpha using [KKALRRQETVDAL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1B(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK1beta using [KKALRRQETVDAL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1D(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK1delta using [KKALRRQETVDAL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type 1G(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK1gamma using [KKALRRQETVDAL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK2alpha using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit beta(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK2beta using [KKALRRQETVDAL] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit delta(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK2delta using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK2gamma using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type IV(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK4 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMKK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMKK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCell division cycle 7-related protein kinase/Protein DBF4 homolog A(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDC7/DBF4 using [[protein fragment, 39 aa]] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK1/cyclin B using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G1/S-specific cyclin- 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK1/cyclin E using RP protein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/cyclin A using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/cyclin E using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK3/cyclin E using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK4/cyclin D1 using RB-CTF as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK4/cyclin D3 using RB-CTF as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MAPKAPK3 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MAPKAPK5 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK1 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK2 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK3 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 337 total ) | Next | Last >>