Compile Data Set for Download or QSAR
maximum 50k data
Found 4 of ki for monomerid = 50425005
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50425005(CHEMBL2312188)
Affinity DataKi:  11nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50425005(CHEMBL2312188)
Affinity DataKi:  11nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50425005(CHEMBL2312188)
Affinity DataKi:  12nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Oxford

Curated by ChEMBL
LigandPNGBDBM50425005(CHEMBL2312188)
Affinity DataKi:  12nMAssay Description:Inhibition of CDK2/Cyclin A (174 to 432 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair