BindingDB logo
myBDB logout
Compile Data Set for Download or QSAR

Found 2 hits Enz. Inhib. hit(s) with Target = 'Cyclin-K'   
Trg + Lig

(Homo sapiens)
Show SMILES Nc1nc(Nc2ccc(cc2)S(N)(=O)=O)sc1C(=O)c1ccccc1[N+]([O-])=O
Show InChI InChI=1S/C16H13N5O5S2/c17-15-14(13(22)11-3-1-2-4-12(11)21(23)24)27-16(20-15)19-9-5-7-10(8-6-9)28(18,25)26/h1-8H,17H2,(H,19,20)(H2,18,25,26)



PC cid
PC sid
n/an/a 13n/an/an/an/an/an/a

H. Lee Moffitt Cancer Center and Research Institute

Curated by ChEMBL

Assay Description
Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...

J Med Chem 56: 3768-82 (2013)

More data for this
Ligand-Target Pair

(Homo sapiens)
Show SMILES Cn1c2nc(Nc3ccc4[nH]ccc4c3)ncc2cc(c1=O)S(=O)(=O)c1ccc(F)cc1F
Show InChI InChI=1S/C22H15F2N5O3S/c1-29-20-13(9-19(21(29)30)33(31,32)18-5-2-14(23)10-16(18)24)11-26-22(28-20)27-15-3-4-17-12(8-15)6-7-25-17/h2-11,25H,1H3,(H,26,27,28)



PC cid
PC sid




Icahn School of Medicine at Mount Sinai

Curated by ChEMBL

Assay Description
Inhibition of human CDK9/cyclin K using [[protein fragment, 39 aa]] as substrate

Bioorg Med Chem 24: 521-44 (2016)

More data for this
Ligand-Target Pair