BindingDB logo
myBDB logout
Compile Data Set for Download or QSAR

Found 1180 hits Enz. Inhib. hit(s) with Target = '3-phosphoinositide-dependent protein kinase 1 (PDK1)' AND taxid = 9606   
Trg + Lig
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCC[C@@H]3c3ccc(F)cc3)n2)c2c(N)ncnc12
Show InChI InChI=1S/C25H26FN7O/c1-14(2)33-12-18(22-24(27)29-13-30-25(22)33)23(34)20-10-28-11-21(32-20)31-19-5-3-4-17(19)15-6-8-16(26)9-7-15/h6-14,17,19H,3-5H2,1-2H3,(H,31,32)(H2,27,29,30)/t17-,19-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3COC[C@@H]3c3ccc(F)cc3)n2)c2c(N)ncnc12
Show InChI InChI=1S/C24H24FN7O2/c1-13(2)32-9-16(21-23(26)28-12-29-24(21)32)22(33)18-7-27-8-20(30-18)31-19-11-34-10-17(19)14-3-5-15(25)6-4-14/h3-9,12-13,17,19H,10-11H2,1-2H3,(H,30,31)(H2,26,28,29)/t17-,19-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3D Structure (crystal)
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCN(C=O)[C@@H]3c3ccc(F)cc3)n2)c2c(N)ncnc12
Show InChI InChI=1S/C25H25FN8O2/c1-14(2)34-11-17(21-24(27)29-12-30-25(21)34)23(36)19-9-28-10-20(32-19)31-18-7-8-33(13-35)22(18)15-3-5-16(26)6-4-15/h3-6,9-14,18,22H,7-8H2,1-2H3,(H,31,32)(H2,27,29,30)/t18-,22-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(n2)N(C)[C@@H]2CCC[C@@H]2c2ccc(F)cc2)c2c(N)ncnc12
Show InChI InChI=1S/C26H28FN7O/c1-15(2)34-13-19(23-25(28)30-14-31-26(23)34)24(35)20-11-29-12-22(32-20)33(3)21-6-4-5-18(21)16-7-9-17(27)10-8-16/h7-15,18,21H,4-6H2,1-3H3,(H2,28,30,31)/t18-,21-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCN[C@@H]3c3ccc(F)cc3)n2)c2c(N)ncnc12
Show InChI InChI=1S/C24H25FN8O/c1-13(2)33-11-16(20-23(26)29-12-30-24(20)33)22(34)18-9-27-10-19(32-18)31-17-7-8-28-21(17)14-3-5-15(25)6-4-14/h3-6,9-13,17,21,28H,7-8H2,1-2H3,(H,31,32)(H2,26,29,30)/t17-,21-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCO[C@@H]3c3ccc(F)cc3)n2)c2c(N)ncnc12
Show InChI InChI=1S/C24H24FN7O2/c1-13(2)32-11-16(20-23(26)28-12-29-24(20)32)21(33)18-9-27-10-19(31-18)30-17-7-8-34-22(17)14-3-5-15(25)6-4-14/h3-6,9-13,17,22H,7-8H2,1-2H3,(H,30,31)(H2,26,28,29)/t17-,22-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCN([C@@H]3c3ccccc3)C(C)=O)n2)c2c(N)ncnc12
Show InChI InChI=1S/C26H28N8O2/c1-15(2)34-13-18(22-25(27)29-14-30-26(22)34)24(36)20-11-28-12-21(32-20)31-19-9-10-33(16(3)35)23(19)17-7-5-4-6-8-17/h4-8,11-15,19,23H,9-10H2,1-3H3,(H,31,32)(H2,27,29,30)/t19-,23-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCN([C@@H]3c3ccc(F)cc3)C(C)=O)n2)c2c(N)ncnc12
Show InChI InChI=1S/C26H27FN8O2/c1-14(2)35-12-18(22-25(28)30-13-31-26(22)35)24(37)20-10-29-11-21(33-20)32-19-8-9-34(15(3)36)23(19)16-4-6-17(27)7-5-16/h4-7,10-14,19,23H,8-9H2,1-3H3,(H,32,33)(H2,28,30,31)/t19-,23-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CCC[C@@H]3c3ccccc3)n2)c2c(N)ncnc12
Show InChI InChI=1S/C25H27N7O/c1-15(2)32-13-18(22-24(26)28-14-29-25(22)32)23(33)20-11-27-12-21(31-20)30-19-10-6-9-17(19)16-7-4-3-5-8-16/h3-5,7-8,11-15,17,19H,6,9-10H2,1-2H3,(H,30,31)(H2,26,28,29)/t17-,19-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(N[C@@H]3CNC[C@@H]3c3ccc(F)cc3)n2)c2c(N)ncnc12
Show InChI InChI=1S/C24H25FN8O/c1-13(2)33-11-17(21-23(26)29-12-30-24(21)33)22(34)19-9-28-10-20(32-19)31-18-8-27-7-16(18)14-3-5-15(25)6-4-14/h3-6,9-13,16,18,27H,7-8H2,1-2H3,(H,31,32)(H2,26,29,30)/t16-,18-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)n1cc(C(=O)c2cncc(NCCc3cccnc3)n2)c2c(N)ncnc12
Show InChI InChI=1S/C21H22N8O/c1-13(2)29-11-15(18-20(22)26-12-27-21(18)29)19(30)16-9-24-10-17(28-16)25-7-5-14-4-3-6-23-8-14/h3-4,6,8-13H,5,7H2,1-2H3,(H,25,28)(H2,22,26,27)

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3D Structure (crystal)
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CC(C)(C)Nc1c(Nc2ccnc(Nc3ccc(cc3)-c3ccncc3)n2)c(=O)c1=O
Show InChI InChI=1S/C23H22N6O2/c1-23(2,3)29-19-18(20(30)21(19)31)27-17-10-13-25-22(28-17)26-16-6-4-14(5-7-16)15-8-11-24-12-9-15/h4-13,29H,1-3H3,(H2,25,26,27,28)

NCI pathway
Reactome pathway


PC cid
PC sid



Abbott Laboratories

Curated by ChEMBL

Assay Description
Inhibition of recombinant PDK1 after 1 hr by scintillation counter analysis in presence of gamma-[33P]ATP

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CNc1cncc(n1)C(=O)c1cn(C(C)C)c2ncnc(N)c12
Show InChI InChI=1S/C15H17N7O/c1-8(2)22-6-9(12-14(16)19-7-20-15(12)22)13(23)10-4-18-5-11(17-3)21-10/h4-8H,1-3H3,(H,17,21)(H2,16,19,20)

NCI pathway
Reactome pathway


PC cid
PC sid



Pfizer Inc.

Curated by ChEMBL

Assay Description
Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISA

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(CHEMBL1765751 | N-{(3R,5R)-1-[2-Amino-6-(3-amino-1...)
Show SMILES C[C@@H]1C[C@H](CN(C1)c1cc(nc(N)n1)-c1ccc2c(N)n[nH]c2c1)N(C)C(=O)CC(C)(C)C
Show InChI InChI=1S/C24H34N8O/c1-14-8-16(31(5)21(33)11-24(2,3)4)13-32(12-14)20-10-18(27-23(26)28-20)15-6-7-17-19(9-15)29-30-22(17)25/h6-7,9-10,14,16H,8,11-13H2,1-5H3,(H3,25,29,30)(H2,26,27,28)/t14-,16-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



n/an/a 0.631n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of PDK1

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CNc1nc(cc(n1)-c1ccc2c(N)n[nH]c2c1)N1C[C@H](C)C[C@H](C1)N(C)C(=O)OC(C)(C)C
Show InChI InChI=1S/C24H34N8O2/c1-14-9-16(31(6)23(33)34-24(2,3)4)13-32(12-14)20-11-18(27-22(26-5)28-20)15-7-8-17-19(10-15)29-30-21(17)25/h7-8,10-11,14,16H,9,12-13H2,1-6H3,(H3,25,29,30)(H,26,27,28)/t14-,16-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid


n/an/a 0.794n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of PDK1

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-50)
Show SMILES CCN1CCC(CC1)Nc1cnc2ccc(cc2n1)C#CCNC(=O)c1cccn([C@@H](CO)c2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C32H32F2N6O3/c1-2-39-15-11-23(12-16-39)37-30-19-36-27-10-7-21(17-28(27)38-30)5-3-13-35-31(42)24-6-4-14-40(32(24)43)29(20-41)22-8-9-25(33)26(34)18-22/h4,6-10,14,17-19,23,29,41H,2,11-13,15-16,20H2,1H3,(H,35,42)(H,37,38)/t29-/m0/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-70)
Show SMILES CN1CCC(CC1)Nc1cnc2ccc(cc2c1)C#CCNC(=O)c1cncn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C30H28F2N6O2/c1-37-11-8-23(9-12-37)36-24-15-22-13-20(5-7-28(22)35-16-24)3-2-10-34-29(39)25-17-33-19-38(30(25)40)18-21-4-6-26(31)27(32)14-21/h4-7,13-17,19,23,36H,8-12,18H2,1H3,(H,34,39)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-75)
Show SMILES CCN1CCC(CC1)Nc1cnc2ccc(cc2c1)C#CCNC(=O)c1cccn([C@@H](C)c2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C33H33F2N5O2/c1-3-39-16-12-26(13-17-39)38-27-19-25-18-23(8-11-31(25)37-21-27)6-4-14-36-32(41)28-7-5-15-40(33(28)42)22(2)24-9-10-29(34)30(35)20-24/h5,7-11,15,18-22,26,38H,3,12-14,16-17H2,1-2H3,(H,36,41)/t22-/m0/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, II-17)
Show SMILES CC(C)n1c(C)nc2cnc3ccc(cc3c12)C#CCNC(=O)c1cccn([C@@H](C)c2ccc(F)c(F)c2)c1=O
Show InChI InChI=1/C31H27F2N5O2/c1-18(2)38-20(4)36-28-17-35-27-12-9-21(15-24(27)29(28)38)7-5-13-34-30(39)23-8-6-14-37(31(23)40)19(3)22-10-11-25(32)26(33)16-22/h6,8-12,14-19H,13H2,1-4H3,(H,34,39)/t19-/s2

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, I-1)
Show SMILES Fc1ccc(Cn2cncc(C(=O)NCC#Cc3ccc4ncc5nc[nH]c5c4c3)c2=O)cc1F
Show InChI InChI=1S/C25H16F2N6O2/c26-19-5-3-16(9-20(19)27)12-33-14-28-10-18(25(33)35)24(34)29-7-1-2-15-4-6-21-17(8-15)23-22(11-30-21)31-13-32-23/h3-6,8-11,13-14H,7,12H2,(H,29,34)(H,31,32)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, II-6)
Show SMILES CC(C)n1c(C)nc2cnc3ccc(cc3c12)C#CCNC(=O)c1cccn([C@H](CO)c2cccc(F)c2)c1=O
Show InChI InChI=1/C31H28FN5O3/c1-19(2)37-20(3)35-27-17-34-26-12-11-21(15-25(26)29(27)37)7-5-13-33-30(39)24-10-6-14-36(31(24)40)28(18-38)22-8-4-9-23(32)16-22/h4,6,8-12,14-17,19,28,38H,13,18H2,1-3H3,(H,33,39)/t28-/s2

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, III-31)
Show SMILES CCn1cnc2cnc3ccc(cc3c12)C#CCNC(=O)c1cncn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C27H20F2N6O2/c1-2-34-16-33-24-13-32-23-8-6-17(10-19(23)25(24)34)4-3-9-31-26(36)20-12-30-15-35(27(20)37)14-18-5-7-21(28)22(29)11-18/h5-8,10-13,15-16H,2,9,14H2,1H3,(H,31,36)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, II-19)
Show SMILES COc1cc(C(=O)NCC#Cc2ccc3ncc4nc(C)n(C(C)C)c4c3c2)c(=O)n(Cc2ccc(F)c(F)c2)n1
Show InChI InChI=1S/C30H26F2N6O3/c1-17(2)38-18(3)35-26-15-34-25-10-8-19(12-21(25)28(26)38)6-5-11-33-29(39)22-14-27(41-4)36-37(30(22)40)16-20-7-9-23(31)24(32)13-20/h7-10,12-15,17H,11,16H2,1-4H3,(H,33,39)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, III-5)
Show SMILES C[C@@H](c1ccc(F)c(F)c1)n1cccc(C(=O)NCC#Cc2ccc3ncc4nc(C)n([C@@H]5CC[C@@H](CC5)N(C)C)c4c3c2)c1=O
Show InChI InChI=1/C36H36F2N6O2/c1-22(25-10-15-30(37)31(38)20-25)43-18-6-8-28(36(43)46)35(45)39-17-5-7-24-9-16-32-29(19-24)34-33(21-40-32)41-23(2)44(34)27-13-11-26(12-14-27)42(3)4/h6,8-10,15-16,18-22,26-27H,11-14,17H2,1-4H3,(H,39,45)/t22-,26-,27+/s2

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, III-14)
Show SMILES CN1CCC(CC1)n1cnc2cnc3ccc(cc3c12)C#CCNC(=O)c1cc(Cl)nn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C31H26ClF2N7O2/c1-39-11-8-21(9-12-39)40-18-37-27-16-36-26-7-5-19(13-22(26)29(27)40)3-2-10-35-30(42)23-15-28(32)38-41(31(23)43)17-20-4-6-24(33)25(34)14-20/h4-7,13-16,18,21H,8-12,17H2,1H3,(H,35,42)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, III-23)
Show SMILES C[C@@H](c1ccc(F)c(F)c1)n1cccc(C(=O)NCC#Cc2ccc3ncc4nc(C)n([C@H]5CC[C@@H](CC5)N(C)C)c4c3c2)c1=O
Show InChI InChI=1/C36H36F2N6O2/c1-22(25-10-15-30(37)31(38)20-25)43-18-6-8-28(36(43)46)35(45)39-17-5-7-24-9-16-32-29(19-24)34-33(21-40-32)41-23(2)44(34)27-13-11-26(12-14-27)42(3)4/h6,8-10,15-16,18-22,26-27H,11-14,17H2,1-4H3,(H,39,45)/t22-,26-,27-/s2

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, III-26)
Show SMILES CN(C)[C@H]1CC[C@@H](CC1)n1cnc2cnc3ccc(cc3c12)C#CCNC(=O)c1cccn([C@@H](CO)c2cccc(F)c2)c1=O
Show InChI InChI=1/C35H35FN6O3/c1-40(2)26-11-13-27(14-12-26)42-22-39-31-20-38-30-15-10-23(18-29(30)33(31)42)6-4-16-37-34(44)28-9-5-17-41(35(28)45)32(21-43)24-7-3-8-25(36)19-24/h3,5,7-10,15,17-20,22,26-27,32,43H,11-14,16,21H2,1-2H3,(H,37,44)/t26-,27-,32-/s2

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 1n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
Show SMILES CNc1nc(cc(n1)-c1ccc2c(N)n[nH]c2c1)N1C[C@H](CC[C@H]1C)C(=O)Nc1ccccc1
Show InChI InChI=1S/C25H28N8O/c1-15-8-9-17(24(34)28-18-6-4-3-5-7-18)14-33(15)22-13-20(29-25(27-2)30-22)16-10-11-19-21(12-16)31-32-23(19)26/h3-7,10-13,15,17H,8-9,14H2,1-2H3,(H,28,34)(H3,26,31,32)(H,27,29,30)/t15-,17+/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid



n/an/a 1.60n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of PDK1

Citation and Details
More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-124)
Show SMILES CC(c1ccc(F)c(F)c1)n1cccc(C(=O)NCC#Cc2ccc3nccc(OCCCN(C)C)c3c2)c1=O
Show InChI InChI=1S/C31H30F2N4O3/c1-21(23-10-11-26(32)27(33)20-23)37-17-5-8-24(31(37)39)30(38)35-14-4-7-22-9-12-28-25(19-22)29(13-15-34-28)40-18-6-16-36(2)3/h5,8-13,15,17,19-21H,6,14,16,18H2,1-3H3,(H,35,38)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, III-33)
Show SMILES CCn1c(C)nc2cnc3ccc(cc3c12)C#CCNC(=O)c1cncn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C28H22F2N6O2/c1-3-36-17(2)34-25-14-33-24-9-7-18(11-20(24)26(25)36)5-4-10-32-27(37)21-13-31-16-35(28(21)38)15-19-6-8-22(29)23(30)12-19/h6-9,11-14,16H,3,10,15H2,1-2H3,(H,32,37)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-123)
Show SMILES Fc1ccc(Cn2cncc(C(=O)NCC#Cc3ccc4nccc(OCC5CCCNC5)c4c3)c2=O)cc1F
Show InChI InChI=1S/C30H27F2N5O3/c31-25-7-5-21(14-26(25)32)17-37-19-34-16-24(30(37)39)29(38)36-11-2-3-20-6-8-27-23(13-20)28(9-12-35-27)40-18-22-4-1-10-33-15-22/h5-9,12-14,16,19,22,33H,1,4,10-11,15,17-18H2,(H,36,38)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-125.9)
Show SMILES CN1CC[C@H](COc2ccnc3ccc(cc23)C#CCNC(=O)c2cccn(Cc3cc(F)c(F)c(F)c3)c2=O)C1
Show InChI InChI=1S/C31H27F3N4O3/c1-37-13-9-21(17-37)19-41-28-8-11-35-27-7-6-20(14-24(27)28)4-2-10-36-30(39)23-5-3-12-38(31(23)40)18-22-15-25(32)29(34)26(33)16-22/h3,5-8,11-12,14-16,21H,9-10,13,17-19H2,1H3,(H,36,39)/t21-/m0/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-125.18)
Show SMILES CC(c1cc(F)c(F)c(F)c1)n1cccc(C(=O)NCC#Cc2ccc3nccc(OC[C@@H]4CCCN(C)C4)c3c2)c1=O
Show InChI InChI=1S/C33H31F3N4O3/c1-21(24-17-27(34)31(36)28(35)18-24)40-15-5-8-25(33(40)42)32(41)38-12-3-6-22-9-10-29-26(16-22)30(11-13-37-29)43-20-23-7-4-14-39(2)19-23/h5,8-11,13,15-18,21,23H,4,7,12,14,19-20H2,1-2H3,(H,38,41)/t21?,23-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-125.17)
Show SMILES CN1CCC[C@@H](COc2ccnc3ccc(cc23)C#CCNC(=O)c2cccn(Cc3cc(F)c(F)c(F)c3)c2=O)C1
Show InChI InChI=1S/C32H29F3N4O3/c1-38-13-3-6-22(18-38)20-42-29-10-12-36-28-9-8-21(15-25(28)29)5-2-11-37-31(40)24-7-4-14-39(32(24)41)19-23-16-26(33)30(35)27(34)17-23/h4,7-10,12,14-17,22H,3,6,11,13,18-20H2,1H3,(H,37,40)/t22-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-125.21)
Show SMILES CN1CCC[C@@H](COc2ccnc3ccc(cc23)C#CCNC(=O)c2cccn(C(CO)c3cc(F)c(F)c(F)c3)c2=O)C1
Show InChI InChI=1S/C33H31F3N4O4/c1-39-13-3-6-22(18-39)20-44-30-10-12-37-28-9-8-21(15-25(28)30)5-2-11-38-32(42)24-7-4-14-40(33(24)43)29(19-41)23-16-26(34)31(36)27(35)17-23/h4,7-10,12,14-17,22,29,41H,3,6,11,13,18-20H2,1H3,(H,38,42)/t22-,29?/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-125)
Show SMILES CN(C)CCCOc1ccnc2ccc(cc12)C#CCNC(=O)c1cccn(C(CO)c2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C31H30F2N4O4/c1-36(2)15-5-17-41-29-12-14-34-27-11-8-21(18-24(27)29)6-3-13-35-30(39)23-7-4-16-37(31(23)40)28(20-38)22-9-10-25(32)26(33)19-22/h4,7-12,14,16,18-19,28,38H,5,13,15,17,20H2,1-2H3,(H,35,39)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, III-32)
Show SMILES CC(C)n1cnc2cnc3ccc(cc3c12)C#CCNC(=O)c1cncn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C28H22F2N6O2/c1-17(2)36-16-34-25-13-33-24-8-6-18(10-20(24)26(25)36)4-3-9-32-27(37)21-12-31-15-35(28(21)38)14-19-5-7-22(29)23(30)11-19/h5-8,10-13,15-17H,9,14H2,1-2H3,(H,32,37)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, III-28)
Show SMILES Cc1nc2cnc3ccc(cc3c2n1C1CCCOC1)C#CCNC(=O)c1cncn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1/C31H26F2N6O3/c1-19-37-28-15-36-27-9-7-20(12-23(27)29(28)39(19)22-5-3-11-42-17-22)4-2-10-35-30(40)24-14-34-18-38(31(24)41)16-21-6-8-25(32)26(33)13-21/h6-9,12-15,18,22H,3,5,10-11,16-17H2,1H3,(H,35,40)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-51)
Show SMILES CCN1CCC(CC1)Nc1cnc2ccc(cc2n1)C#CCNC(=O)c1cncn([C@@H](C)c2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C31H31F2N7O2/c1-3-39-13-10-23(11-14-39)37-29-18-36-27-9-6-21(15-28(27)38-29)5-4-12-35-30(41)24-17-34-19-40(31(24)42)20(2)22-7-8-25(32)26(33)16-22/h6-9,15-20,23H,3,10-14H2,1-2H3,(H,35,41)(H,37,38)/t20-/m0/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-61)
Show SMILES OC[C@H](c1cccc(F)c1)n1cccc(C(=O)NCC#Cc2ccc3ncc(N[C@H]4CC[C@@H](CC4)N4CCN(CC5CC5)CC4)nc3c2)c1=O
Show InChI InChI=1S/C39H44FN7O3/c40-30-6-1-5-29(23-30)36(26-48)47-17-3-7-33(39(47)50)38(49)41-16-2-4-27-10-15-34-35(22-27)44-37(24-42-34)43-31-11-13-32(14-12-31)46-20-18-45(19-21-46)25-28-8-9-28/h1,3,5-7,10,15,17,22-24,28,31-32,36,48H,8-9,11-14,16,18-21,25-26H2,(H,41,49)(H,43,44)/t31-,32-,36-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-62)
Show SMILES Fc1ccc(Cn2nccc(C(=O)NCC#Cc3ccc4ncc(N[C@H]5CC[C@@H](CC5)N5CCN(CC6CC6)CC5)nc4c3)c2=O)cc1F
Show InChI InChI=1S/C37H40F2N8O2/c38-31-11-5-27(20-32(31)39)24-47-37(49)30(13-15-42-47)36(48)40-14-1-2-25-6-12-33-34(21-25)44-35(22-41-33)43-28-7-9-29(10-8-28)46-18-16-45(17-19-46)23-26-3-4-26/h5-6,11-13,15,20-22,26,28-29H,3-4,7-10,14,16-19,23-24H2,(H,40,48)(H,43,44)/t28-,29-

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-72)
Show SMILES CCN1CCC(CC1)Nc1cnc2ccc(cc2c1)C#CCNC(=O)c1cccn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C32H31F2N5O2/c1-2-38-15-11-25(12-16-38)37-26-19-24-17-22(8-10-30(24)36-20-26)5-3-13-35-31(40)27-6-4-14-39(32(27)41)21-23-7-9-28(33)29(34)18-23/h4,6-10,14,17-20,25,37H,2,11-13,15-16,21H2,1H3,(H,35,40)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-76)
Show SMILES CCN1CCC(CC1)Nc1cnc2ccc(cc2c1)C#CCNC(=O)c1cccn([C@H](CO)c2cccc(F)c2)c1=O
Show InChI InChI=1S/C33H34FN5O3/c1-2-38-16-12-27(13-17-38)37-28-20-25-18-23(10-11-30(25)36-21-28)6-4-14-35-32(41)29-9-5-15-39(33(29)42)31(22-40)24-7-3-8-26(34)19-24/h3,5,7-11,15,18-21,27,31,37,40H,2,12-14,16-17,22H2,1H3,(H,35,41)/t31-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-30)
Show SMILES C[C@H](c1ccc(F)c(F)c1)n1cccc(C(=O)NCC#Cc2ccc3ncc(NC4CCN(C)CC4)nc3c2)c1=O
Show InChI InChI=1S/C31H30F2N6O2/c1-20(22-8-9-25(32)26(33)18-22)39-14-4-6-24(31(39)41)30(40)34-13-3-5-21-7-10-27-28(17-21)37-29(19-35-27)36-23-11-15-38(2)16-12-23/h4,6-10,14,17-20,23H,11-13,15-16H2,1-2H3,(H,34,40)(H,36,37)/t20-/m1/s1

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8575203, I-40)
Show SMILES Fc1ccc(Cn2cncc(C(=O)NCC#Cc3ccc4ncc(N[C@H]5CC[C@@H](CC5)N5CCOCC5)nc4c3)c2=O)cc1F
Show InChI InChI=1S/C33H33F2N7O3/c34-27-9-3-23(16-28(27)35)20-42-21-36-18-26(33(42)44)32(43)37-11-1-2-22-4-10-29-30(17-22)40-31(19-38-29)39-24-5-7-25(8-6-24)41-12-14-45-15-13-41/h3-4,9-10,16-19,21,24-25H,5-8,11-15,20H2,(H,37,43)(H,39,40)/t24-,25-

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...

US Patent US8575203 (2013)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, I-4)
Show SMILES OCCCn1cnc2cnc3ccc(cc3c12)C#CCNC(=O)c1cncn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C28H22F2N6O3/c29-22-6-4-19(12-23(22)30)15-36-16-31-13-21(28(36)39)27(38)32-8-1-3-18-5-7-24-20(11-18)26-25(14-33-24)34-17-35(26)9-2-10-37/h4-7,11-14,16-17,37H,2,8-10,15H2,(H,32,38)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, I-10)
Show SMILES CN1CCC(CC1)n1cnc2cnc3ccc(cc3c12)C#CCNC(=O)c1cncn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C31H27F2N7O2/c1-38-11-8-22(9-12-38)40-19-37-28-16-36-27-7-5-20(13-23(27)29(28)40)3-2-10-35-30(41)24-15-34-18-39(31(24)42)17-21-4-6-25(32)26(33)14-21/h4-7,13-16,18-19,22H,8-12,17H2,1H3,(H,35,41)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, II-1)
Show SMILES CC(C)n1c(C)nc2cnc3ccc(cc3c12)C#CCNC(=O)c1cc(C)nn([C@H](C)c2ccc(F)c(F)c2)c1=O
Show InChI InChI=1/C31H28F2N6O2/c1-17(2)38-20(5)36-28-16-35-27-11-8-21(14-23(27)29(28)38)7-6-12-34-30(40)24-13-18(3)37-39(31(24)41)19(4)22-9-10-25(32)26(33)15-22/h8-11,13-17,19H,12H2,1-5H3,(H,34,40)/t19-/s2

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, II-3)
Show SMILES CC(C)n1c(C)nc2cnc3ccc(cc3c12)C#CCNC(=O)c1cccn(Cc2ccc(F)c(F)c2)c1=O
Show InChI InChI=1S/C30H25F2N5O2/c1-18(2)37-19(3)35-27-16-34-26-11-9-20(14-23(26)28(27)37)6-4-12-33-29(38)22-7-5-13-36(30(22)39)17-21-8-10-24(31)25(32)15-21/h5,7-11,13-16,18H,12,17H2,1-3H3,(H,33,38)

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
3-phosphoinositide dependent protein kinase-1

(Homo sapiens (human))
(US8895581, II-9)
Show SMILES CC(C)n1c(C)nc2cnc3ccc(cc3c12)C#CCNC(=O)c1cccn([C@H](CO)c2ccc(F)c(F)c2)c1=O
Show InChI InChI=1/C31H27F2N5O3/c1-18(2)38-19(3)36-27-16-35-26-11-8-20(14-23(26)29(27)38)6-4-12-34-30(40)22-7-5-13-37(31(22)41)28(17-39)21-9-10-24(32)25(33)15-21/h5,7-11,13-16,18,28,39H,12,17H2,1-3H3,(H,34,40)/t28-/s2

NCI pathway
Reactome pathway


PC cid
PC sid


US Patent
n/an/a 2n/an/an/an/an/an/a

Boehringer Ingelheim International GmbH

US Patent

Assay Description
Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...

US Patent US8895581 (2014)

More data for this
Ligand-Target Pair
Displayed 1 to 50 (of 1180 total )  |  Next  |  Last  >>
Jump to: