BindingDB logo
myBDB logout
Compile Data Set for Download or QSAR

Found 3724 hits Enz. Inhib. hit(s) with Target = 'Glucagon'   
Target/Host
(Institution)
LigandTarget/Host
Links
Ligand
Links
Trg + Lig
Links
Ki
nM
ΔG°
kJ/mole
IC50
nM
Kd
nM
EC50/IC50
nM
koff
s-1
kon
M-1s-1
pHTemp
°C
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231952
PNG
(CHEMBL4081554)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)[C@H](CS)C(N)=O
Show InChI InChI=1/C184H281N49O59S2/c1-16-94(10)147(178(287)213-115(52-58-144(255)256)164(273)218-122(73-101-77-195-106-39-24-23-38-103(101)106)169(278)215-117(68-90(2)3)166(275)205-108(41-26-28-61-186)159(268)219-123(75-134(189)241)155(264)198-79-135(242)196-83-139(246)230-63-31-44-130(230)176(285)224-127(86-236)175(284)222-125(84-234)156(265)200-80-136(243)202-96(12)181(290)232-65-32-45-131(232)183(292)233-66-33-46-132(233)182(291)231-64-30-43-129(231)150(259)104(88-293)151(190)260)228-171(280)120(71-99-34-19-17-20-35-99)217-167(276)118(69-91(4)5)214-160(269)109(42-29-62-194-184(191)192)212-177(286)146(93(8)9)227-152(261)95(11)203-157(266)112(49-55-141(249)250)208-162(271)113(50-56-142(251)252)209-163(272)114(51-57-143(253)254)210-165(274)116(59-67-294-15)211-161(270)111(47-53-133(188)240)207-158(267)107(40-25-27-60-185)206-173(282)126(85-235)223-168(277)119(70-92(6)7)216-170(279)124(76-145(257)258)220-174(283)128(87-237)225-180(289)149(98(14)239)229-172(281)121(72-100-36-21-18-22-37-100)221-179(288)148(97(13)238)226-138(245)82-199-154(263)110(48-54-140(247)248)204-137(244)81-197-153(262)105(187)74-102-78-193-89-201-102/h17-24,34-39,77-78,89-98,104-105,107-132,146-149,195,234-239,293H,16,25-33,40-76,79-88,185-187H2,1-15H3,(H2,188,240)(H2,189,241)(H2,190,260)(H,193,201)(H,196,242)(H,197,262)(H,198,264)(H,199,263)(H,200,265)(H,202,243)(H,203,266)(H,204,244)(H,205,275)(H,206,282)(H,207,267)(H,208,271)(H,209,272)(H,210,274)(H,211,270)(H,212,286)(H,213,287)(H,214,269)(H,215,278)(H,216,279)(H,217,276)(H,218,273)(H,219,268)(H,220,283)(H,221,288)(H,222,284)(H,223,277)(H,224,285)(H,225,289)(H,226,245)(H,227,261)(H,228,280)(H,229,281)(H,247,248)(H,249,250)(H,251,252)(H,253,254)(H,255,256)(H,257,258)(H4,191,192,194)/t94-,95-,96-,97+,98+,104-,105-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,146-,147-,148-,149-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Patents

Article
PubMed
0.110n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231900
PNG
(CHEMBL4060480)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C155H229N41O47/c1-15-79(8)125(152(241)174-83(12)131(220)182-110(63-90-66-165-96-34-23-22-33-94(90)96)143(232)184-105(58-77(4)5)145(234)194-124(78(6)7)151(240)181-98(35-24-26-54-156)134(223)167-69-117(206)175-97(37-28-56-164-155(161)162)133(222)166-68-116(160)205)195-146(235)108(59-86-29-18-16-19-30-86)185-139(228)103(49-53-122(213)214)180-138(227)99(36-25-27-55-157)177-129(218)81(10)171-128(217)80(9)173-137(226)102(46-50-115(159)204)176-118(207)70-168-136(225)101(48-52-121(211)212)179-140(229)104(57-76(2)3)183-141(230)106(61-88-38-42-92(202)43-39-88)187-148(237)112(72-197)191-150(239)113(73-198)190-142(231)107(62-89-40-44-93(203)45-41-89)186-144(233)111(65-123(215)216)188-149(238)114(74-199)192-154(243)127(85(14)201)196-147(236)109(60-87-31-20-17-21-32-87)189-153(242)126(84(13)200)193-119(208)71-169-135(224)100(47-51-120(209)210)178-130(219)82(11)172-132(221)95(158)64-91-67-163-75-170-91/h16-23,29-34,38-45,66-67,75-85,95,97-114,124-127,165,197-203H,15,24-28,35-37,46-65,68-74,156-158H2,1-14H3,(H2,159,204)(H2,160,205)(H,163,170)(H,166,222)(H,167,223)(H,168,225)(H,169,224)(H,171,217)(H,172,221)(H,173,226)(H,174,241)(H,175,206)(H,176,207)(H,177,218)(H,178,219)(H,179,229)(H,180,227)(H,181,240)(H,182,220)(H,183,230)(H,184,232)(H,185,228)(H,186,233)(H,187,237)(H,188,238)(H,189,242)(H,190,231)(H,191,239)(H,192,243)(H,193,208)(H,194,234)(H,195,235)(H,196,236)(H,209,210)(H,211,212)(H,213,214)(H,215,216)(H4,161,162,164)/t79-,80-,81-,82-,83-,84+,85+,95-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,124-,125-,126-,127-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.230n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assay


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50261506
PNG
(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C151H229N41O46/c1-17-77(10)121(148(236)170-81(14)127(215)178-105(60-87-63-161-92-36-25-24-35-90(87)92)138(226)180-101(56-74(4)5)139(227)189-119(75(6)7)146(234)177-94(37-26-28-52-152)130(218)163-66-112(201)171-93(39-30-54-160-151(157)158)129(217)162-65-111(156)200)191-140(228)103(57-84-31-20-18-21-32-84)181-135(223)99(47-51-117(208)209)176-134(222)95(38-27-29-53-153)173-125(213)79(12)167-124(212)78(11)169-133(221)98(44-48-110(155)199)172-113(202)67-164-132(220)97(46-50-116(206)207)175-136(224)100(55-73(2)3)179-137(225)102(59-86-40-42-89(198)43-41-86)182-143(231)107(69-193)185-145(233)109(71-195)186-147(235)120(76(8)9)190-142(230)106(62-118(210)211)183-144(232)108(70-194)187-150(238)123(83(16)197)192-141(229)104(58-85-33-22-19-23-34-85)184-149(237)122(82(15)196)188-114(203)68-165-131(219)96(45-49-115(204)205)174-126(214)80(13)168-128(216)91(154)61-88-64-159-72-166-88/h18-25,31-36,40-43,63-64,72-83,91,93-109,119-123,161,193-198H,17,26-30,37-39,44-62,65-71,152-154H2,1-16H3,(H2,155,199)(H2,156,200)(H,159,166)(H,162,217)(H,163,218)(H,164,220)(H,165,219)(H,167,212)(H,168,216)(H,169,221)(H,170,236)(H,171,201)(H,172,202)(H,173,213)(H,174,214)(H,175,224)(H,176,222)(H,177,234)(H,178,215)(H,179,225)(H,180,226)(H,181,223)(H,182,231)(H,183,232)(H,184,237)(H,185,233)(H,186,235)(H,187,238)(H,188,203)(H,189,227)(H,190,230)(H,191,228)(H,192,229)(H,204,205)(H,206,207)(H,208,209)(H,210,211)(H4,157,158,160)/t77-,78-,79-,80-,81-,82+,83+,91-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,119-,120-,121-,122-,123-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.320n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assay


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231888
PNG
(CHEMBL4081357)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N1)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C156H236N42O46/c1-17-80(10)125(153(242)175-84(14)131(220)184-109(64-90-68-167-95-38-25-24-37-93(90)95)143(232)186-105(60-77(4)5)145(234)195-123(78(6)7)151(240)183-97(39-26-29-55-157)134(223)169-71-117(207)176-96(42-32-58-166-156(162)163)133(222)168-70-115(161)205)197-146(235)107(61-87-33-20-18-21-34-87)188-139(228)102(49-53-120(211)212)180-137(226)98(40-27-30-56-158)177-129(218)82(12)172-128(217)81(11)174-136(225)101(47-51-114(160)204)181-144(233)110-66-116(206)165-57-31-28-41-99(138(227)187-106(63-89-43-45-92(203)46-44-89)142(231)185-104(59-76(2)3)141(230)182-103(140(229)189-110)50-54-121(213)214)179-149(238)112(73-199)192-152(241)124(79(8)9)196-148(237)111(67-122(215)216)190-150(239)113(74-200)193-155(244)127(86(16)202)198-147(236)108(62-88-35-22-19-23-36-88)191-154(243)126(85(15)201)194-118(208)72-170-135(224)100(48-52-119(209)210)178-130(219)83(13)173-132(221)94(159)65-91-69-164-75-171-91/h18-25,33-38,43-46,68-69,75-86,94,96-113,123-127,167,199-203H,17,26-32,39-42,47-67,70-74,157-159H2,1-16H3,(H2,160,204)(H2,161,205)(H,164,171)(H,165,206)(H,168,222)(H,169,223)(H,170,224)(H,172,217)(H,173,221)(H,174,225)(H,175,242)(H,176,207)(H,177,218)(H,178,219)(H,179,238)(H,180,226)(H,181,233)(H,182,230)(H,183,240)(H,184,220)(H,185,231)(H,186,232)(H,187,227)(H,188,228)(H,189,229)(H,190,239)(H,191,243)(H,192,241)(H,193,244)(H,194,208)(H,195,234)(H,196,237)(H,197,235)(H,198,236)(H,209,210)(H,211,212)(H,213,214)(H,215,216)(H4,162,163,166)/t80-,81-,82-,83-,84-,85+,86+,94-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,123-,124-,125-,126-,127-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.350n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231942
PNG
(CHEMBL4065403)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C157H229N41O48/c1-15-79(8)126(154(244)182-99-36-25-27-55-165-118(208)65-111(136(226)170-70-119(209)176-97(37-28-56-166-157(162)163)134(224)168-69-117(161)207)191-153(243)125(78(6)7)196-147(237)105(58-77(4)5)184-145(235)110(188-140(99)230)63-90-67-167-96-34-23-22-33-94(90)96)197-148(238)108(59-86-29-18-16-19-30-86)185-141(231)103(49-53-123(215)216)180-139(229)98(35-24-26-54-158)177-130(220)81(10)172-129(219)80(9)174-137(227)101(46-50-116(160)206)179-132(222)83(12)175-138(228)102(48-52-122(213)214)181-142(232)104(57-76(2)3)183-143(233)106(61-88-38-42-92(204)43-39-88)187-150(240)113(72-199)193-152(242)114(73-200)192-144(234)107(62-89-40-44-93(205)45-41-89)186-146(236)112(66-124(217)218)189-151(241)115(74-201)194-156(246)128(85(14)203)198-149(239)109(60-87-31-20-17-21-32-87)190-155(245)127(84(13)202)195-120(210)71-169-135(225)100(47-51-121(211)212)178-131(221)82(11)173-133(223)95(159)64-91-68-164-75-171-91/h16-23,29-34,38-45,67-68,75-85,95,97-115,125-128,167,199-205H,15,24-28,35-37,46-66,69-74,158-159H2,1-14H3,(H2,160,206)(H2,161,207)(H,164,171)(H,165,208)(H,168,224)(H,169,225)(H,170,226)(H,172,219)(H,173,223)(H,174,227)(H,175,228)(H,176,209)(H,177,220)(H,178,221)(H,179,222)(H,180,229)(H,181,232)(H,182,244)(H,183,233)(H,184,235)(H,185,231)(H,186,236)(H,187,240)(H,188,230)(H,189,241)(H,190,245)(H,191,243)(H,192,234)(H,193,242)(H,194,246)(H,195,210)(H,196,237)(H,197,238)(H,198,239)(H,211,212)(H,213,214)(H,215,216)(H,217,218)(H4,162,163,166)/t79-,80-,81-,82-,83-,84+,85+,95-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,125-,126-,127-,128-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.470n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231949
PNG
(CHEMBL4069162)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C156H227N41O48/c1-14-79(8)126(153(243)181-98-35-24-26-54-164-117(207)64-110(136(226)170-70-118(208)175-96(36-27-55-165-156(161)162)133(223)167-68-116(160)206)190-152(242)125(78(6)7)195-146(236)104(57-77(4)5)183-144(234)109(187-139(98)229)62-89-66-166-95-33-22-21-32-93(89)95)196-147(237)107(58-85-28-17-15-18-29-85)184-140(230)102(48-52-123(215)216)180-138(228)97(34-23-25-53-157)177-130(220)81(10)172-129(219)80(9)174-137(227)101(45-49-115(159)205)176-119(209)69-168-135(225)100(47-51-122(213)214)179-141(231)103(56-76(2)3)182-142(232)105(60-87-37-41-91(203)42-38-87)186-149(239)112(72-198)192-151(241)113(73-199)191-143(233)106(61-88-39-43-92(204)44-40-88)185-145(235)111(65-124(217)218)188-150(240)114(74-200)193-155(245)128(84(13)202)197-148(238)108(59-86-30-19-16-20-31-86)189-154(244)127(83(12)201)194-120(210)71-169-134(224)99(46-50-121(211)212)178-131(221)82(11)173-132(222)94(158)63-90-67-163-75-171-90/h15-22,28-33,37-44,66-67,75-84,94,96-114,125-128,166,198-204H,14,23-27,34-36,45-65,68-74,157-158H2,1-13H3,(H2,159,205)(H2,160,206)(H,163,171)(H,164,207)(H,167,223)(H,168,225)(H,169,224)(H,170,226)(H,172,219)(H,173,222)(H,174,227)(H,175,208)(H,176,209)(H,177,220)(H,178,221)(H,179,231)(H,180,228)(H,181,243)(H,182,232)(H,183,234)(H,184,230)(H,185,235)(H,186,239)(H,187,229)(H,188,240)(H,189,244)(H,190,242)(H,191,233)(H,192,241)(H,193,245)(H,194,210)(H,195,236)(H,196,237)(H,197,238)(H,211,212)(H,213,214)(H,215,216)(H,217,218)(H4,161,162,165)/t79-,80-,81-,82-,83+,84+,94-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,125-,126-,127-,128-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.490n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231943
PNG
(CHEMBL4093072)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(N)=O
Show InChI InChI=1/C150H231N41O48S/c1-15-77(10)121(147(237)177-96(43-49-118(210)211)135(225)182-103(60-83-64-161-87-34-23-22-33-85(83)87)140(230)179-98(55-73(2)3)137(227)169-89(36-25-27-52-152)130(220)183-104(62-109(155)197)127(217)164-67-111(199)162-66-110(156)198)190-142(232)101(58-81-29-18-16-19-30-81)181-138(228)99(56-74(4)5)178-131(221)90(37-28-53-160-150(157)158)176-146(236)120(76(8)9)189-124(214)78(11)167-128(218)93(40-46-115(204)205)172-133(223)94(41-47-116(206)207)173-134(224)95(42-48-117(208)209)174-136(226)97(50-54-240-14)175-132(222)92(38-44-108(154)196)171-129(219)88(35-24-26-51-151)170-144(234)106(70-192)186-139(229)100(57-75(6)7)180-141(231)105(63-119(212)213)184-145(235)107(71-193)187-149(239)123(80(13)195)191-143(233)102(59-82-31-20-17-21-32-82)185-148(238)122(79(12)194)188-113(201)69-165-126(216)91(39-45-114(202)203)168-112(200)68-163-125(215)86(153)61-84-65-159-72-166-84/h16-23,29-34,64-65,72-80,86,88-107,120-123,161,192-195H,15,24-28,35-63,66-71,151-153H2,1-14H3,(H2,154,196)(H2,155,197)(H2,156,198)(H,159,166)(H,162,199)(H,163,215)(H,164,217)(H,165,216)(H,167,218)(H,168,200)(H,169,227)(H,170,234)(H,171,219)(H,172,223)(H,173,224)(H,174,226)(H,175,222)(H,176,236)(H,177,237)(H,178,221)(H,179,230)(H,180,231)(H,181,228)(H,182,225)(H,183,220)(H,184,235)(H,185,238)(H,186,229)(H,187,239)(H,188,201)(H,189,214)(H,190,232)(H,191,233)(H,202,203)(H,204,205)(H,206,207)(H,208,209)(H,210,211)(H,212,213)(H4,157,158,160)/t77-,78-,79+,80+,86-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,120-,121-,122-,123-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.490n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231887
PNG
(CHEMBL4091638)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N1)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C150H224N42O47/c1-13-75(6)120(147(237)170-79(10)126(216)179-103(59-85-63-161-90-34-21-20-33-88(85)90)137(227)180-99(55-73(2)3)140(230)190-119(74(4)5)146(236)178-92(35-22-25-51-151)129(219)163-66-112(202)171-91(38-28-54-160-150(156)157)128(218)162-65-110(155)200)191-141(231)101(56-82-29-16-14-17-30-82)181-135(225)98(46-50-117(209)210)177-133(223)93(36-23-26-52-152)173-124(214)77(8)167-123(213)76(7)169-132(222)97(43-47-109(154)199)172-113(203)67-164-131(221)96(45-49-116(207)208)176-138(228)104-61-111(201)159-53-27-24-37-94(134(224)186-107(70-194)145(235)187-106(69-193)143(233)182-100(136(226)183-104)58-84-39-41-87(198)42-40-84)175-139(229)105(62-118(211)212)184-144(234)108(71-195)188-149(239)122(81(12)197)192-142(232)102(57-83-31-18-15-19-32-83)185-148(238)121(80(11)196)189-114(204)68-165-130(220)95(44-48-115(205)206)174-125(215)78(9)168-127(217)89(153)60-86-64-158-72-166-86/h14-21,29-34,39-42,63-64,72-81,89,91-108,119-122,161,193-198H,13,22-28,35-38,43-62,65-71,151-153H2,1-12H3,(H2,154,199)(H2,155,200)(H,158,166)(H,159,201)(H,162,218)(H,163,219)(H,164,221)(H,165,220)(H,167,213)(H,168,217)(H,169,222)(H,170,237)(H,171,202)(H,172,203)(H,173,214)(H,174,215)(H,175,229)(H,176,228)(H,177,223)(H,178,236)(H,179,216)(H,180,227)(H,181,225)(H,182,233)(H,183,226)(H,184,234)(H,185,238)(H,186,224)(H,187,235)(H,188,239)(H,189,204)(H,190,230)(H,191,231)(H,192,232)(H,205,206)(H,207,208)(H,209,210)(H,211,212)(H4,156,157,160)/t75-,76-,77-,78-,79-,80+,81+,89-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,119-,120-,121-,122-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.520n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor (GLP-1)


(Homo sapiens (Human))
BDBM50086603
PNG
(CHEMBL3426241)
Show SMILES CCc1cc(OC)ccc1-c1ccc(C[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@](C)(Cc2ccccc2F)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)C(C)(C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CCCc2ccccc2)C(N)=O)cc1
Show InChI InChI=1/C71H93FN14O19/c1-8-42-30-46(105-7)25-26-47(42)43-23-21-41(22-24-43)29-52(63(98)78-50(60(74)95)20-14-17-40-15-10-9-11-16-40)79-64(99)53(32-57(93)94)80-65(100)54(36-87)81-66(101)58(38(2)88)84-69(104)71(6,33-44-18-12-13-19-48(44)72)86-67(102)59(39(3)89)83-55(90)35-76-62(97)51(27-28-56(91)92)82-68(103)70(4,5)85-61(96)49(73)31-45-34-75-37-77-45/h9-13,15-16,18-19,21-26,30,34,37-39,49-54,58-59,87-89H,8,14,17,20,27-29,31-33,35-36,73H2,1-7H3,(H2,74,95)(H,75,77)(H,76,97)(H,78,98)(H,79,99)(H,80,100)(H,81,101)(H,82,103)(H,83,90)(H,84,104)(H,85,96)(H,86,102)(H,91,92)(H,93,94)/t38-,39-,49+,50+,51+,52+,53+,54+,58+,59+,71+/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.570n/an/an/an/an/an/an/an/a



University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...


J Med Chem 58: 4080-5 (2015)


Article DOI: 10.1021/acs.jmedchem.5b00166
BindingDB Entry DOI: 10.7270/Q2DB83KP
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor (GLP-1)


(Homo sapiens (Human))
BDBM50301953
PNG
((3S,6S,9S,12S,15S,21S)-21-(2-((S)-2-amino-3-(1H-im...)
Show SMILES CCc1cc(OC)ccc1-c1ccc(C[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@](C)(Cc2c(F)cccc2F)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)C(C)(C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](Cc2ccc(cc2)-c2ccccc2C)C(N)=O)cc1
Show InChI InChI=1/C76H94F2N14O19/c1-9-44-31-48(111-8)25-26-50(44)46-23-19-43(20-24-46)30-57(68(104)84-56(65(80)101)29-42-17-21-45(22-18-42)49-14-11-10-13-39(49)2)85-69(105)58(33-62(99)100)86-70(106)59(37-93)87-71(107)63(40(3)94)90-74(110)76(7,34-51-52(77)15-12-16-53(51)78)92-72(108)64(41(4)95)89-60(96)36-82-67(103)55(27-28-61(97)98)88-73(109)75(5,6)91-66(102)54(79)32-47-35-81-38-83-47/h10-26,31,35,38,40-41,54-59,63-64,93-95H,9,27-30,32-34,36-37,79H2,1-8H3,(H2,80,101)(H,81,83)(H,82,103)(H,84,104)(H,85,105)(H,86,106)(H,87,107)(H,88,109)(H,89,96)(H,90,110)(H,91,102)(H,92,108)(H,97,98)(H,99,100)/t40-,41-,54+,55+,56+,57+,58+,59+,63+,64+,76+/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.660n/an/an/an/an/an/an/an/a



University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...


J Med Chem 58: 4080-5 (2015)


Article DOI: 10.1021/acs.jmedchem.5b00166
BindingDB Entry DOI: 10.7270/Q2DB83KP
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231894
PNG
(CHEMBL4100325)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCCNC(=O)CC[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N1)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C157H238N42O46/c1-17-81(10)126(154(243)176-85(14)132(221)186-111(66-91-69-168-96-38-25-24-37-94(91)96)145(234)188-107(62-78(4)5)146(235)196-124(79(6)7)152(241)185-98(39-26-29-57-158)135(224)170-72-118(208)177-97(42-32-60-167-157(163)164)134(223)169-71-116(162)206)198-147(236)109(63-88-33-20-18-21-34-88)190-142(231)105(51-56-122(214)215)182-138(227)99(40-27-30-58-159)178-130(219)83(12)173-129(218)82(11)175-137(226)102(47-52-115(161)205)181-139(228)100-41-28-31-59-166-117(207)53-48-103(141(230)189-108(65-90-43-45-93(204)46-44-90)144(233)187-106(61-77(2)3)143(232)183-104(140(229)180-100)50-55-121(212)213)184-150(239)113(74-200)193-153(242)125(80(8)9)197-149(238)112(68-123(216)217)191-151(240)114(75-201)194-156(245)128(87(16)203)199-148(237)110(64-89-35-22-19-23-36-89)192-155(244)127(86(15)202)195-119(209)73-171-136(225)101(49-54-120(210)211)179-131(220)84(13)174-133(222)95(160)67-92-70-165-76-172-92/h18-25,33-38,43-46,69-70,76-87,95,97-114,124-128,168,200-204H,17,26-32,39-42,47-68,71-75,158-160H2,1-16H3,(H2,161,205)(H2,162,206)(H,165,172)(H,166,207)(H,169,223)(H,170,224)(H,171,225)(H,173,218)(H,174,222)(H,175,226)(H,176,243)(H,177,208)(H,178,219)(H,179,220)(H,180,229)(H,181,228)(H,182,227)(H,183,232)(H,184,239)(H,185,241)(H,186,221)(H,187,233)(H,188,234)(H,189,230)(H,190,231)(H,191,240)(H,192,244)(H,193,242)(H,194,245)(H,195,209)(H,196,235)(H,197,238)(H,198,236)(H,199,237)(H,210,211)(H,212,213)(H,214,215)(H,216,217)(H4,163,164,167)/t81-,82-,83-,84-,85-,86+,87+,95-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,124-,125-,126-,127-,128-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.800n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231902
PNG
(CHEMBL4096416)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCC(=O)NCCCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N1)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C162H236N42O48/c1-14-83(8)131(159(250)189-103-38-25-28-60-171-123(214)70-116(140(231)176-75-124(215)181-100(39-29-61-172-162(167)168)138(229)174-74-121(166)212)198-158(249)130(82(6)7)202-153(244)110(63-81(4)5)191-151(242)115(195-144(103)235)68-93-72-173-99-35-22-21-34-97(93)99)203-154(245)113(64-89-30-17-15-18-31-89)193-147(238)108(52-57-128(221)222)187-142(233)101(36-23-26-58-163)182-135(226)85(10)178-134(225)84(9)180-141(232)105(48-53-120(165)211)185-145(236)106-49-54-122(213)170-59-27-24-37-102(143(234)192-111(66-91-40-44-95(209)45-41-91)149(240)190-109(62-80(2)3)148(239)188-107(146(237)186-106)51-56-127(219)220)184-156(247)118(77-205)199-150(241)112(67-92-42-46-96(210)47-43-92)194-152(243)117(71-129(223)224)196-157(248)119(78-206)200-161(252)133(88(13)208)204-155(246)114(65-90-32-19-16-20-33-90)197-160(251)132(87(12)207)201-125(216)76-175-139(230)104(50-55-126(217)218)183-136(227)86(11)179-137(228)98(164)69-94-73-169-79-177-94/h15-22,30-35,40-47,72-73,79-88,98,100-119,130-133,173,205-210H,14,23-29,36-39,48-71,74-78,163-164H2,1-13H3,(H2,165,211)(H2,166,212)(H,169,177)(H,170,213)(H,171,214)(H,174,229)(H,175,230)(H,176,231)(H,178,225)(H,179,228)(H,180,232)(H,181,215)(H,182,226)(H,183,227)(H,184,247)(H,185,236)(H,186,237)(H,187,233)(H,188,239)(H,189,250)(H,190,240)(H,191,242)(H,192,234)(H,193,238)(H,194,243)(H,195,235)(H,196,248)(H,197,251)(H,198,249)(H,199,241)(H,200,252)(H,201,216)(H,202,244)(H,203,245)(H,204,246)(H,217,218)(H,219,220)(H,221,222)(H,223,224)(H4,167,168,172)/t83-,84-,85-,86-,87+,88+,98-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,130-,131-,132-,133-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.820n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231962
PNG
(CHEMBL4099379)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCC(=O)NCCCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N1)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C157H238N42O46/c1-17-81(10)126(154(243)176-85(14)132(221)186-111(66-91-69-168-96-38-25-24-37-94(91)96)145(234)188-107(62-78(4)5)146(235)196-124(79(6)7)152(241)185-98(39-26-29-57-158)135(224)170-72-118(208)177-97(42-32-60-167-157(163)164)134(223)169-71-116(162)206)198-147(236)109(63-88-33-20-18-21-34-88)190-142(231)105(51-56-122(214)215)183-138(227)99(40-27-30-58-159)178-130(219)83(12)173-129(218)82(11)175-137(226)102(47-52-115(161)205)181-140(229)103-48-53-117(207)166-59-31-28-41-100(139(228)189-108(65-90-43-45-93(204)46-44-90)144(233)187-106(61-77(2)3)143(232)184-104(141(230)182-103)50-55-121(212)213)180-150(239)113(74-200)193-153(242)125(80(8)9)197-149(238)112(68-123(216)217)191-151(240)114(75-201)194-156(245)128(87(16)203)199-148(237)110(64-89-35-22-19-23-36-89)192-155(244)127(86(15)202)195-119(209)73-171-136(225)101(49-54-120(210)211)179-131(220)84(13)174-133(222)95(160)67-92-70-165-76-172-92/h18-25,33-38,43-46,69-70,76-87,95,97-114,124-128,168,200-204H,17,26-32,39-42,47-68,71-75,158-160H2,1-16H3,(H2,161,205)(H2,162,206)(H,165,172)(H,166,207)(H,169,223)(H,170,224)(H,171,225)(H,173,218)(H,174,222)(H,175,226)(H,176,243)(H,177,208)(H,178,219)(H,179,220)(H,180,239)(H,181,229)(H,182,230)(H,183,227)(H,184,232)(H,185,241)(H,186,221)(H,187,233)(H,188,234)(H,189,228)(H,190,231)(H,191,240)(H,192,244)(H,193,242)(H,194,245)(H,195,209)(H,196,235)(H,197,238)(H,198,236)(H,199,237)(H,210,211)(H,212,213)(H,214,215)(H,216,217)(H4,163,164,167)/t81-,82-,83-,84-,85-,86+,87+,95-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,124-,125-,126-,127-,128-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.840n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231896
PNG
(CHEMBL4084829)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N1)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C157H234N42O47/c1-16-80(10)126(154(244)183-98-40-27-30-55-165-116(207)65-109(135(225)171-71-118(209)176-95(41-31-57-167-157(162)163)133(223)169-70-115(161)206)192-152(242)124(78(6)7)196-146(236)104(59-77(4)5)185-144(234)108(188-139(98)229)63-89-68-168-94-37-24-23-36-92(89)94)198-147(237)106(60-86-32-19-17-20-33-86)187-140(230)101(48-52-121(213)214)180-137(227)96(38-25-28-54-158)177-130(220)82(12)173-129(219)81(11)175-136(226)100(46-50-114(160)205)181-145(235)110-66-117(208)166-56-29-26-39-97(138(228)186-105(62-88-42-44-91(204)45-43-88)143(233)184-103(58-76(2)3)142(232)182-102(141(231)189-110)49-53-122(215)216)179-150(240)112(73-200)193-153(243)125(79(8)9)197-149(239)111(67-123(217)218)190-151(241)113(74-201)194-156(246)128(85(15)203)199-148(238)107(61-87-34-21-18-22-35-87)191-155(245)127(84(14)202)195-119(210)72-170-134(224)99(47-51-120(211)212)178-131(221)83(13)174-132(222)93(159)64-90-69-164-75-172-90/h17-24,32-37,42-45,68-69,75-85,93,95-113,124-128,168,200-204H,16,25-31,38-41,46-67,70-74,158-159H2,1-15H3,(H2,160,205)(H2,161,206)(H,164,172)(H,165,207)(H,166,208)(H,169,223)(H,170,224)(H,171,225)(H,173,219)(H,174,222)(H,175,226)(H,176,209)(H,177,220)(H,178,221)(H,179,240)(H,180,227)(H,181,235)(H,182,232)(H,183,244)(H,184,233)(H,185,234)(H,186,228)(H,187,230)(H,188,229)(H,189,231)(H,190,241)(H,191,245)(H,192,242)(H,193,243)(H,194,246)(H,195,210)(H,196,236)(H,197,239)(H,198,237)(H,199,238)(H,211,212)(H,213,214)(H,215,216)(H,217,218)(H4,162,163,167)/t80-,81-,82-,83-,84+,85+,93-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,124-,125-,126-,127-,128-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
0.940n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231895
PNG
(CHEMBL4073486)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C152H227N41O47/c1-16-77(10)122(149(238)177-94-37-26-28-52-160-112(202)61-105(132(221)166-67-113(203)171-92(38-29-53-161-152(157)158)129(218)163-65-111(156)201)185-147(236)120(75(6)7)190-140(229)100(55-74(4)5)179-139(228)104(182-135(94)224)59-86-63-162-91-35-24-23-34-89(86)91)192-141(230)102(56-83-30-19-17-20-31-83)180-136(225)98(46-50-118(210)211)176-134(223)93(36-25-27-51-153)173-126(215)79(12)168-125(214)78(11)170-133(222)97(43-47-110(155)200)172-114(204)66-164-131(220)96(45-49-117(208)209)175-137(226)99(54-73(2)3)178-138(227)101(58-85-39-41-88(199)42-40-85)181-144(233)107(69-194)186-146(235)109(71-196)187-148(237)121(76(8)9)191-143(232)106(62-119(212)213)183-145(234)108(70-195)188-151(240)124(82(15)198)193-142(231)103(57-84-32-21-18-22-33-84)184-150(239)123(81(14)197)189-115(205)68-165-130(219)95(44-48-116(206)207)174-127(216)80(13)169-128(217)90(154)60-87-64-159-72-167-87/h17-24,30-35,39-42,63-64,72-82,90,92-109,120-124,162,194-199H,16,25-29,36-38,43-62,65-71,153-154H2,1-15H3,(H2,155,200)(H2,156,201)(H,159,167)(H,160,202)(H,163,218)(H,164,220)(H,165,219)(H,166,221)(H,168,214)(H,169,217)(H,170,222)(H,171,203)(H,172,204)(H,173,215)(H,174,216)(H,175,226)(H,176,223)(H,177,238)(H,178,227)(H,179,228)(H,180,225)(H,181,233)(H,182,224)(H,183,234)(H,184,239)(H,185,236)(H,186,235)(H,187,237)(H,188,240)(H,189,205)(H,190,229)(H,191,232)(H,192,230)(H,193,231)(H,206,207)(H,208,209)(H,210,211)(H,212,213)(H4,157,158,161)/t77-,78-,79-,80-,81+,82+,90-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,120-,121-,122-,123-,124-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
1.10n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assay


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231948
PNG
(CHEMBL4066463)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N1)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C152H224N42O48/c1-13-75(6)121(149(240)179-94-37-24-27-52-160-112(203)61-104(131(222)166-67-114(205)172-91(38-28-54-162-152(157)158)129(220)164-66-111(156)202)187-148(239)120(74(4)5)192-142(233)99(55-73(2)3)180-139(230)103(183-135(94)226)59-85-64-163-90-34-21-20-33-88(85)90)193-143(234)101(56-82-29-16-14-17-30-82)181-137(228)98(46-50-118(211)212)177-134(225)92(35-22-25-51-153)173-125(216)77(8)168-124(215)76(7)170-132(223)96(43-47-110(155)201)175-127(218)79(10)171-133(224)97(45-49-117(209)210)178-140(231)105-62-113(204)161-53-26-23-36-93(136(227)188-108(70-196)147(238)189-107(69-195)145(236)182-100(138(229)184-105)58-84-39-41-87(200)42-40-84)176-141(232)106(63-119(213)214)185-146(237)109(71-197)190-151(242)123(81(12)199)194-144(235)102(57-83-31-18-15-19-32-83)186-150(241)122(80(11)198)191-115(206)68-165-130(221)95(44-48-116(207)208)174-126(217)78(9)169-128(219)89(154)60-86-65-159-72-167-86/h14-21,29-34,39-42,64-65,72-81,89,91-109,120-123,163,195-200H,13,22-28,35-38,43-63,66-71,153-154H2,1-12H3,(H2,155,201)(H2,156,202)(H,159,167)(H,160,203)(H,161,204)(H,164,220)(H,165,221)(H,166,222)(H,168,215)(H,169,219)(H,170,223)(H,171,224)(H,172,205)(H,173,216)(H,174,217)(H,175,218)(H,176,232)(H,177,225)(H,178,231)(H,179,240)(H,180,230)(H,181,228)(H,182,236)(H,183,226)(H,184,229)(H,185,237)(H,186,241)(H,187,239)(H,188,227)(H,189,238)(H,190,242)(H,191,206)(H,192,233)(H,193,234)(H,194,235)(H,207,208)(H,209,210)(H,211,212)(H,213,214)(H4,157,158,162)/t75-,76-,77-,78-,79-,80+,81+,89-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,120-,121-,122-,123-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
1.40n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231947
PNG
(CHEMBL4062134)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N1)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C151H222N42O48/c1-12-75(6)121(148(239)178-93-36-23-26-51-159-111(202)60-103(131(222)166-67-113(204)171-90(37-27-53-161-151(156)157)128(219)163-65-110(155)201)186-147(238)120(74(4)5)191-141(232)98(54-73(2)3)179-138(229)102(182-134(93)225)58-84-63-162-89-33-20-19-32-87(84)89)192-142(233)100(55-81-28-15-13-16-29-81)180-136(227)97(45-49-118(211)212)177-133(224)91(34-21-24-50-152)173-125(216)77(8)168-124(215)76(7)170-132(223)96(42-46-109(154)200)172-114(205)66-164-130(221)95(44-48-117(209)210)176-139(230)104-61-112(203)160-52-25-22-35-92(135(226)187-107(70-195)146(237)188-106(69-194)144(235)181-99(137(228)183-104)57-83-38-40-86(199)41-39-83)175-140(231)105(62-119(213)214)184-145(236)108(71-196)189-150(241)123(80(11)198)193-143(234)101(56-82-30-17-14-18-31-82)185-149(240)122(79(10)197)190-115(206)68-165-129(220)94(43-47-116(207)208)174-126(217)78(9)169-127(218)88(153)59-85-64-158-72-167-85/h13-20,28-33,38-41,63-64,72-80,88,90-108,120-123,162,194-199H,12,21-27,34-37,42-62,65-71,152-153H2,1-11H3,(H2,154,200)(H2,155,201)(H,158,167)(H,159,202)(H,160,203)(H,163,219)(H,164,221)(H,165,220)(H,166,222)(H,168,215)(H,169,218)(H,170,223)(H,171,204)(H,172,205)(H,173,216)(H,174,217)(H,175,231)(H,176,230)(H,177,224)(H,178,239)(H,179,229)(H,180,227)(H,181,235)(H,182,225)(H,183,228)(H,184,236)(H,185,240)(H,186,238)(H,187,226)(H,188,237)(H,189,241)(H,190,206)(H,191,232)(H,192,233)(H,193,234)(H,207,208)(H,209,210)(H,211,212)(H,213,214)(H4,156,157,161)/t75-,76-,77-,78-,79+,80+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,120-,121-,122-,123-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
1.40n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231898
PNG
(CHEMBL4079909)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(C)C)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C155H233N41O47/c1-18-79(12)124(152(241)178-96-39-28-30-54-163-114(205)63-107(133(222)168-68-115(206)173-94(40-31-55-164-155(160)161)131(220)166-67-113(159)204)187-150(239)122(77(8)9)193-142(231)102(57-75(4)5)181-141(230)106(184-136(96)225)61-88-65-165-93-37-26-25-36-91(88)93)195-143(232)104(58-85-32-21-19-22-33-85)182-137(226)99(47-51-118(210)211)176-135(224)95(38-27-29-53-156)174-128(217)81(14)170-127(216)80(13)172-134(223)98(45-49-112(158)203)179-149(238)121(76(6)7)192-138(227)100(48-52-119(212)213)177-139(228)101(56-74(2)3)180-140(229)103(60-87-41-43-90(202)44-42-87)183-146(235)109(70-197)188-148(237)111(72-199)189-151(240)123(78(10)11)194-145(234)108(64-120(214)215)185-147(236)110(71-198)190-154(243)126(84(17)201)196-144(233)105(59-86-34-23-20-24-35-86)186-153(242)125(83(16)200)191-116(207)69-167-132(221)97(46-50-117(208)209)175-129(218)82(15)171-130(219)92(157)62-89-66-162-73-169-89/h19-26,32-37,41-44,65-66,73-84,92,94-111,121-126,165,197-202H,18,27-31,38-40,45-64,67-72,156-157H2,1-17H3,(H2,158,203)(H2,159,204)(H,162,169)(H,163,205)(H,166,220)(H,167,221)(H,168,222)(H,170,216)(H,171,219)(H,172,223)(H,173,206)(H,174,217)(H,175,218)(H,176,224)(H,177,228)(H,178,241)(H,179,238)(H,180,229)(H,181,230)(H,182,226)(H,183,235)(H,184,225)(H,185,236)(H,186,242)(H,187,239)(H,188,237)(H,189,240)(H,190,243)(H,191,207)(H,192,227)(H,193,231)(H,194,234)(H,195,232)(H,196,233)(H,208,209)(H,210,211)(H,212,213)(H,214,215)(H4,160,161,164)/t79-,80-,81-,82-,83+,84+,92-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,121-,122-,123-,124-,125-,126-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
1.5n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231899
PNG
(CHEMBL4087789)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@H]1CCCCNC(=O)C[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC1=O)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C153H229N41O47/c1-17-77(10)122(150(239)178-95-38-27-29-53-161-113(203)62-106(132(221)166-67-114(204)172-93(39-30-54-162-153(158)159)130(219)164-66-112(157)202)186-148(237)120(75(6)7)191-141(230)101(56-74(4)5)180-140(229)105(183-136(95)225)60-87-64-163-92-36-25-24-35-90(87)92)193-142(231)103(57-84-31-20-18-21-32-84)181-137(226)99(47-51-118(210)211)176-135(224)94(37-26-28-52-154)173-126(215)79(12)168-125(214)78(11)170-133(222)97(44-48-111(156)201)175-128(217)81(14)171-134(223)98(46-50-117(208)209)177-138(227)100(55-73(2)3)179-139(228)102(59-86-40-42-89(200)43-41-86)182-145(234)108(69-195)187-147(236)110(71-197)188-149(238)121(76(8)9)192-144(233)107(63-119(212)213)184-146(235)109(70-196)189-152(241)124(83(16)199)194-143(232)104(58-85-33-22-19-23-34-85)185-151(240)123(82(15)198)190-115(205)68-165-131(220)96(45-49-116(206)207)174-127(216)80(13)169-129(218)91(155)61-88-65-160-72-167-88/h18-25,31-36,40-43,64-65,72-83,91,93-110,120-124,163,195-200H,17,26-30,37-39,44-63,66-71,154-155H2,1-16H3,(H2,156,201)(H2,157,202)(H,160,167)(H,161,203)(H,164,219)(H,165,220)(H,166,221)(H,168,214)(H,169,218)(H,170,222)(H,171,223)(H,172,204)(H,173,215)(H,174,216)(H,175,217)(H,176,224)(H,177,227)(H,178,239)(H,179,228)(H,180,229)(H,181,226)(H,182,234)(H,183,225)(H,184,235)(H,185,240)(H,186,237)(H,187,236)(H,188,238)(H,189,241)(H,190,205)(H,191,230)(H,192,233)(H,193,231)(H,194,232)(H,206,207)(H,208,209)(H,210,211)(H,212,213)(H4,158,159,162)/t77-,78-,79-,80-,81-,82+,83+,91-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,120-,121-,122-,123-,124-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
1.70n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assay


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50144020
PNG
(3-{4-[1-(4-Benzofuran-2-yl-phenylcarbamoyl)-heptyl...)
Show SMILES CCCCCCC(Oc1ccc(cc1)C(=O)NCCC(O)=O)C(=O)Nc1ccc(cc1)-c1cc2ccccc2o1
Show InChI InChI=1/C32H34N2O6/c1-2-3-4-5-10-28(39-26-17-13-23(14-18-26)31(37)33-20-19-30(35)36)32(38)34-25-15-11-22(12-16-25)29-21-24-8-6-7-9-27(24)40-29/h6-9,11-18,21,28H,2-5,10,19-20H2,1H3,(H,33,37)(H,34,38)(H,35,36)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
3n/an/an/an/an/an/an/an/a



Abbott Laboratories

Curated by ChEMBL


Assay Description
In vitro binding affinity against human glucagon receptor (h-GlucR) was determined


Bioorg Med Chem Lett 14: 2047-50 (2004)


Article DOI: 10.1016/j.bmcl.2004.02.056
BindingDB Entry DOI: 10.7270/Q2XS5TTH
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50144008
PNG
(3-{4-[2-(4-Benzofuran-2-yl-phenylcarbamoyl)-2-(4-t...)
Show SMILES CC(C)(C)c1ccc(cc1)C(Cc1ccc(cc1)C(=O)NCCC(O)=O)C(=O)Nc1ccc(cc1)-c1cc2ccccc2o1
Show InChI InChI=1/C37H36N2O5/c1-37(2,3)29-16-12-25(13-17-29)31(22-24-8-10-27(11-9-24)35(42)38-21-20-34(40)41)36(43)39-30-18-14-26(15-19-30)33-23-28-6-4-5-7-32(28)44-33/h4-19,23,31H,20-22H2,1-3H3,(H,38,42)(H,39,43)(H,40,41)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
4n/an/an/an/an/an/an/an/a



Abbott Laboratories

Curated by ChEMBL


Assay Description
In vitro binding affinity against human glucagon receptor (h-GlucR) was determined


Bioorg Med Chem Lett 14: 2047-50 (2004)


Article DOI: 10.1016/j.bmcl.2004.02.056
BindingDB Entry DOI: 10.7270/Q2XS5TTH
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50360584
PNG
(CHEMBL1933350)
Show SMILES CCC[C@@H]([C@@H](c1c[nH]c2c(F)cc(C)cc12)c1ccc(Cl)cc1)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C30H30ClFN2O3/c1-3-4-23(19-5-7-21(8-6-19)30(37)33-14-13-27(35)36)28(20-9-11-22(31)12-10-20)25-17-34-29-24(25)15-18(2)16-26(29)32/h5-12,15-17,23,28,34H,3-4,13-14H2,1-2H3,(H,33,37)(H,35,36)/t23-,28+/s2
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Patents

Article
PubMed
4n/an/an/an/an/an/an/an/a



Pfizer Inc.

Curated by ChEMBL


Assay Description
Displacement of [125I]Glucagon-Cex from human GCGR


Bioorg Med Chem Lett 22: 415-20 (2011)


Article DOI: 10.1016/j.bmcl.2011.10.113
BindingDB Entry DOI: 10.7270/Q2H70G82
More data for this
Ligand-Target Pair
Glucagon


(Homo sapiens (Human))
BDBM2437
PNG
(US8507533, 157)
Show SMILES CC1(C)CC(C1)C(Nc1cnc(nc1)-n1cc(cn1)C(F)(F)F)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C25H27F3N6O3/c1-24(2)9-17(10-24)21(15-3-5-16(6-4-15)22(37)29-8-7-20(35)36)33-19-12-30-23(31-13-19)34-14-18(11-32-34)25(26,27)28/h3-6,11-14,17,21,33H,7-10H2,1-2H3,(H,29,37)(H,35,36)
Reactome pathway
KEGG

UniProtKB/SwissProt

GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
5.55n/an/an/an/an/an/an/an/a



Pfizer Inc.

US Patent


Assay Description
The Glucagon SPA assay is used to determine the ability of test compounds to block the binding of glucagon-cex to the glucagon receptors.


US Patent US8507533 (2013)


BindingDB Entry DOI: 10.7270/Q23R0RGH
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM2437
PNG
(US8507533, 157)
Show SMILES CC1(C)CC(C1)C(Nc1cnc(nc1)-n1cc(cn1)C(F)(F)F)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C25H27F3N6O3/c1-24(2)9-17(10-24)21(15-3-5-16(6-4-15)22(37)29-8-7-20(35)36)33-19-12-30-23(31-13-19)34-14-18(11-32-34)25(26,27)28/h3-6,11-14,17,21,33H,7-10H2,1-2H3,(H,29,37)(H,35,36)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

Article
PubMed
5.60n/an/an/an/an/an/an/an/a



Pfizer Inc.

Curated by ChEMBL


Assay Description
Displacement of [125I]-glucagon from human glucagon receptor expressed in Chem-1 cell membranes after 6 to 10 hrs by scintillation proximity assay


Bioorg Med Chem Lett 25: 4057-64 (2015)


Article DOI: 10.1016/j.bmcl.2015.07.092
BindingDB Entry DOI: 10.7270/Q2HM5B7N
More data for this
Ligand-Target Pair
Glucagon


(Homo sapiens (Human))
BDBM100827
PNG
(US8507533, 138 | US8507533, 151 | US8507533, 374)
Show SMILES Cc1cc(OC(C2CCC2)c2ccc(cc2)C(=O)NCCC(O)=O)cc(C)c1-n1cc(cn1)C(F)(F)F
Show InChI InChI=1/C27H28F3N3O4/c1-16-12-22(13-17(2)24(16)33-15-21(14-32-33)27(28,29)30)37-25(18-4-3-5-18)19-6-8-20(9-7-19)26(36)31-11-10-23(34)35/h6-9,12-15,18,25H,3-5,10-11H2,1-2H3,(H,31,36)(H,34,35)
Reactome pathway
KEGG

UniProtKB/SwissProt

GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
5.75n/an/an/an/an/an/a7.4n/a



Pfizer Inc.

US Patent


Assay Description
The Glucagon SPA assay is used to determine the ability of test compounds to block the binding of glucagon-cex to the glucagon receptors.


US Patent US8507533 (2013)


BindingDB Entry DOI: 10.7270/Q23R0RGH
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor (GLP-1)


(Homo sapiens (Human))
BDBM50086602
PNG
(CHEMBL3426300)
Show SMILES CCc1cc(OC)ccc1-c1ccc(C[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@](C)(Cc2ccccc2F)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)C(C)(C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](Cc2ccc(O)c(I)c2)C(N)=O)cc1
Show InChI InChI=1/C69H88FIN14O20/c1-8-38-26-42(105-7)18-19-43(38)39-16-13-36(14-17-39)24-49(61(98)77-48(58(73)95)25-37-15-21-52(89)45(71)23-37)78-62(99)50(28-55(93)94)79-63(100)51(32-86)80-64(101)56(34(2)87)83-67(104)69(6,29-40-11-9-10-12-44(40)70)85-65(102)57(35(3)88)82-53(90)31-75-60(97)47(20-22-54(91)92)81-66(103)68(4,5)84-59(96)46(72)27-41-30-74-33-76-41/h9-19,21,23,26,30,33-35,46-51,56-57,86-89H,8,20,22,24-25,27-29,31-32,72H2,1-7H3,(H2,73,95)(H,74,76)(H,75,97)(H,77,98)(H,78,99)(H,79,100)(H,80,101)(H,81,103)(H,82,90)(H,83,104)(H,84,96)(H,85,102)(H,91,92)(H,93,94)/t34-,35-,46+,47+,48+,49+,50+,51+,56+,57+,69+/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
6n/an/an/an/an/an/an/an/a



University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...


J Med Chem 58: 4080-5 (2015)


Article DOI: 10.1021/acs.jmedchem.5b00166
BindingDB Entry DOI: 10.7270/Q2DB83KP
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50144001
PNG
(3-{4-[1-(2',4'-Dichloro-biphenyl-4-ylcarbamoyl)-he...)
Show SMILES CCCCCCC(Oc1ccc(cc1)C(=O)NCCC(O)=O)C(=O)Nc1ccc(cc1)-c1ccc(Cl)cc1Cl
Show InChI InChI=1/C30H32Cl2N2O5/c1-2-3-4-5-6-27(39-24-14-9-21(10-15-24)29(37)33-18-17-28(35)36)30(38)34-23-12-7-20(8-13-23)25-16-11-22(31)19-26(25)32/h7-16,19,27H,2-6,17-18H2,1H3,(H,33,37)(H,34,38)(H,35,36)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
6n/an/an/an/an/an/an/an/a



Abbott Laboratories

Curated by ChEMBL


Assay Description
In vitro binding affinity against human glucagon receptor (h-GlucR) was determined


Bioorg Med Chem Lett 14: 2047-50 (2004)


Article DOI: 10.1016/j.bmcl.2004.02.056
BindingDB Entry DOI: 10.7270/Q2XS5TTH
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50144002
PNG
(3-{4-[2-(4-tert-Butyl-phenyl)-2-(2',4'-dichloro-bi...)
Show SMILES CC(C)(C)c1ccc(cc1)C(Cc1ccc(cc1)C(=O)NCCC(O)=O)C(=O)Nc1ccc(cc1)-c1ccc(Cl)cc1Cl
Show InChI InChI=1/C35H34Cl2N2O4/c1-35(2,3)26-12-8-24(9-13-26)30(20-22-4-6-25(7-5-22)33(42)38-19-18-32(40)41)34(43)39-28-15-10-23(11-16-28)29-17-14-27(36)21-31(29)37/h4-17,21,30H,18-20H2,1-3H3,(H,38,42)(H,39,43)(H,40,41)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
6n/an/an/an/an/an/an/an/a



Abbott Laboratories

Curated by ChEMBL


Assay Description
In vitro binding affinity against human glucagon receptor (h-GlucR) was determined


Bioorg Med Chem Lett 14: 2047-50 (2004)


Article DOI: 10.1016/j.bmcl.2004.02.056
BindingDB Entry DOI: 10.7270/Q2XS5TTH
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50144015
PNG
(3-{4-[2-(4-Benzofuran-2-yl-phenylcarbamoyl)-octyl]...)
Show SMILES CCCCCCC(Cc1ccc(cc1)C(=O)NCCC(O)=O)C(=O)Nc1ccc(cc1)-c1cc2ccccc2o1
Show InChI InChI=1/C33H36N2O5/c1-2-3-4-5-9-27(21-23-11-13-25(14-12-23)32(38)34-20-19-31(36)37)33(39)35-28-17-15-24(16-18-28)30-22-26-8-6-7-10-29(26)40-30/h6-8,10-18,22,27H,2-5,9,19-21H2,1H3,(H,34,38)(H,35,39)(H,36,37)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
6n/an/an/an/an/an/an/an/a



Abbott Laboratories

Curated by ChEMBL


Assay Description
In vitro binding affinity against human glucagon receptor (h-GlucR) was determined


Bioorg Med Chem Lett 14: 2047-50 (2004)


Article DOI: 10.1016/j.bmcl.2004.02.056
BindingDB Entry DOI: 10.7270/Q2XS5TTH
More data for this
Ligand-Target Pair
Glucagon


(Homo sapiens (Human))
BDBM100806
PNG
(US8507533, 114 | US8507533, 115 | US8507533, 330)
Show SMILES CC1(C)CC(C1)C(Nc1ccc(nc1)-n1cc(cn1)C(F)(F)F)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C26H28F3N5O3/c1-25(2)11-18(12-25)23(16-3-5-17(6-4-16)24(37)30-10-9-22(35)36)33-20-7-8-21(31-14-20)34-15-19(13-32-34)26(27,28)29/h3-8,13-15,18,23,33H,9-12H2,1-2H3,(H,30,37)(H,35,36)
Reactome pathway
KEGG

UniProtKB/SwissProt

GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
7.60n/an/an/an/an/an/a7.4n/a



Pfizer Inc.

US Patent


Assay Description
The Glucagon SPA assay is used to determine the ability of test compounds to block the binding of glucagon-cex to the glucagon receptors.


US Patent US8507533 (2013)


BindingDB Entry DOI: 10.7270/Q23R0RGH
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50144016
PNG
(3-{4-[(Biphenyl-4-ylcarbamoyl)-(4-tert-butyl-pheny...)
Show SMILES CC(C)(C)c1ccc(cc1)C(Oc1ccc(cc1)C(=O)NCCC(O)=O)C(=O)Nc1ccc(cc1)-c1ccccc1
Show InChI InChI=1/C34H34N2O5/c1-34(2,3)27-15-9-25(10-16-27)31(41-29-19-13-26(14-20-29)32(39)35-22-21-30(37)38)33(40)36-28-17-11-24(12-18-28)23-7-5-4-6-8-23/h4-20,31H,21-22H2,1-3H3,(H,35,39)(H,36,40)(H,37,38)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
9n/an/an/an/an/an/an/an/a



Abbott Laboratories

Curated by ChEMBL


Assay Description
In vitro binding affinity against human glucagon receptor (h-GlucR) was determined


Bioorg Med Chem Lett 14: 2047-50 (2004)


Article DOI: 10.1016/j.bmcl.2004.02.056
BindingDB Entry DOI: 10.7270/Q2XS5TTH
More data for this
Ligand-Target Pair
Glucagon


(Homo sapiens (Human))
BDBM2390
PNG
(US8507533, 146)
Show SMILES OC(=O)CCNC(=O)c1ccc(cc1)[C@@H](Nc1ccc(nc1)-n1cc(cn1)C(F)(F)F)C1CCCCC1
Show InChI InChI=1/C26H28F3N5O3/c27-26(28,29)20-14-32-34(16-20)22-11-10-21(15-31-22)33-24(17-4-2-1-3-5-17)18-6-8-19(9-7-18)25(37)30-13-12-23(35)36/h6-11,14-17,24,33H,1-5,12-13H2,(H,30,37)(H,35,36)/t24-/s2
Reactome pathway
KEGG

UniProtKB/SwissProt

GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
9.05n/an/an/an/an/an/an/an/a



Pfizer Inc.

US Patent


Assay Description
The Glucagon SPA assay is used to determine the ability of test compounds to block the binding of glucagon-cex to the glucagon receptors.


US Patent US8507533 (2013)


BindingDB Entry DOI: 10.7270/Q23R0RGH
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231886
PNG
(CHEMBL4070761)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CC(=O)NCCCC[C@H](NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N1)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C155H234N42O45/c1-17-80(10)125(152(240)175-84(14)131(219)184-109(64-90-68-166-95-38-25-24-37-93(90)95)143(231)186-105(60-77(4)5)145(233)194-123(78(6)7)150(238)182-97(39-26-29-55-156)134(222)168-71-116(205)176-96(42-32-58-165-155(161)162)133(221)167-70-114(160)203)196-146(234)107(61-87-33-20-18-21-34-87)187-140(228)103(50-54-121(212)213)181-138(226)98(40-27-30-56-157)178-129(217)82(12)172-128(216)81(11)174-137(225)102(47-51-113(159)202)177-117(206)72-169-136(224)101(49-53-120(210)211)180-141(229)104(59-76(2)3)185-142(230)106(63-89-43-45-92(201)46-44-89)188-144(232)110-66-115(204)164-57-31-28-41-99(139(227)190-111(67-122(214)215)148(236)195-124(79(8)9)151(239)192-112(74-198)149(237)189-110)183-154(242)127(86(16)200)197-147(235)108(62-88-35-22-19-23-36-88)191-153(241)126(85(15)199)193-118(207)73-170-135(223)100(48-52-119(208)209)179-130(218)83(13)173-132(220)94(158)65-91-69-163-75-171-91/h18-25,33-38,43-46,68-69,75-86,94,96-112,123-127,166,198-201H,17,26-32,39-42,47-67,70-74,156-158H2,1-16H3,(H2,159,202)(H2,160,203)(H,163,171)(H,164,204)(H,167,221)(H,168,222)(H,169,224)(H,170,223)(H,172,216)(H,173,220)(H,174,225)(H,175,240)(H,176,205)(H,177,206)(H,178,217)(H,179,218)(H,180,229)(H,181,226)(H,182,238)(H,183,242)(H,184,219)(H,185,230)(H,186,231)(H,187,228)(H,188,232)(H,189,237)(H,190,227)(H,191,241)(H,192,239)(H,193,207)(H,194,233)(H,195,236)(H,196,234)(H,197,235)(H,208,209)(H,210,211)(H,212,213)(H,214,215)(H4,161,162,165)/t80-,81-,82-,83-,84-,85+,86+,94-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,123-,124-,125-,126-,127-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
10n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assay


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50144006
PNG
(3-{4-[2-(4-tert-Butyl-phenyl)-2-(quinolin-3-ylcarb...)
Show SMILES CC(C)(C)c1ccc(cc1)C(Cc1ccc(cc1)C(=O)NCCC(O)=O)C(=O)Nc1cnc2ccccc2c1
Show InChI InChI=1/C32H33N3O4/c1-32(2,3)25-14-12-22(13-15-25)27(31(39)35-26-19-24-6-4-5-7-28(24)34-20-26)18-21-8-10-23(11-9-21)30(38)33-17-16-29(36)37/h4-15,19-20,27H,16-18H2,1-3H3,(H,33,38)(H,35,39)(H,36,37)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem
Article
PubMed
11n/an/an/an/an/an/an/an/a



Abbott Laboratories

Curated by ChEMBL


Assay Description
In vitro binding affinity against human glucagon receptor (h-GlucR) was determined


Bioorg Med Chem Lett 14: 2047-50 (2004)


Article DOI: 10.1016/j.bmcl.2004.02.056
BindingDB Entry DOI: 10.7270/Q2XS5TTH
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50144004
PNG
(3-{4-[2-(Biphenyl-4-ylcarbamoyl)-2-(4-tert-butyl-p...)
Show SMILES CC(C)(C)c1ccc(cc1)C(Cc1ccc(cc1)C(=O)NCCC(O)=O)C(=O)Nc1ccc(cc1)-c1ccccc1
Show InChI InChI=1/C35H36N2O4/c1-35(2,3)29-17-13-27(14-18-29)31(23-24-9-11-28(12-10-24)33(40)36-22-21-32(38)39)34(41)37-30-19-15-26(16-20-30)25-7-5-4-6-8-25/h4-20,31H,21-23H2,1-3H3,(H,36,40)(H,37,41)(H,38,39)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
11n/an/an/an/an/an/an/an/a



Abbott Laboratories

Curated by ChEMBL


Assay Description
In vitro binding affinity against human glucagon receptor (h-GlucR) was determined


Bioorg Med Chem Lett 14: 2047-50 (2004)


Article DOI: 10.1016/j.bmcl.2004.02.056
BindingDB Entry DOI: 10.7270/Q2XS5TTH
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50433595
PNG
(CHEMBL2381827)
Show SMILES CCCC(Nc1cc(C)c(c(C)c1)-n1cc(cn1)C(F)(F)F)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C26H29F3N4O3/c1-4-5-22(18-6-8-19(9-7-18)25(36)30-11-10-23(34)35)32-21-12-16(2)24(17(3)13-21)33-15-20(14-31-33)26(27,28)29/h6-9,12-15,22,32H,4-5,10-11H2,1-3H3,(H,30,36)(H,34,35)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
12n/an/an/an/an/an/an/an/a



Pfizer Inc.

Curated by ChEMBL


Assay Description
Displacement of [125I]-glucagon-cex from human glucagon receptor by cell based assay in presence of 0.2% bovine serum albumin


Bioorg Med Chem Lett 23: 3051-8 (2013)


Article DOI: 10.1016/j.bmcl.2013.03.014
BindingDB Entry DOI: 10.7270/Q27M099R
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM123630
PNG
(US8748624, 144)
Show SMILES OC(=O)CCNC(=O)c1ccc(cn1)-c1cc(Cl)ccc1CNc1ccc(c(Cl)c1)-c1ccc(F)c(c1)C(F)(F)F
Show InChI InChI=1S/C29H21Cl2F4N3O3/c30-19-4-1-17(22(12-19)18-3-8-26(38-15-18)28(41)36-10-9-27(39)40)14-37-20-5-6-21(24(31)13-20)16-2-7-25(32)23(11-16)29(33,34)35/h1-8,11-13,15,37H,9-10,14H2,(H,36,41)(H,39,40)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
12.4n/an/an/an/an/an/a7.4n/a



Janssen Pharmaceutica NV

US Patent


Assay Description
The binding assay was performed by a filtration method in a 384 well format. Membranes at a final protein concentration of 6 μg/well were incuba...


US Patent US8748624 (2014)


BindingDB Entry DOI: 10.7270/Q29885QP
More data for this
Ligand-Target Pair
Glucagon


(Homo sapiens (Human))
BDBM142039
PNG
(US8927577, 118 | US8927577, 20 | US8927577, 35)
Show SMILES Cc1cc2cc(F)ccc2nc1NC(C1CC(C)(C)C1)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C27H30FN3O3/c1-16-12-19-13-21(28)8-9-22(19)30-25(16)31-24(20-14-27(2,3)15-20)17-4-6-18(7-5-17)26(34)29-11-10-23(32)33/h4-9,12-13,20,24H,10-11,14-15H2,1-3H3,(H,29,34)(H,30,31)(H,32,33)
Reactome pathway
KEGG

UniProtKB/SwissProt

GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
14n/an/an/an/an/an/a7.4n/a



Pfizer Inc.

US Patent


Assay Description
The Glucagon SPA assay is used to determine the ability of test compounds to block the binding of glucagon-cex to the glucagon receptor. Test compoun...


US Patent US8927577 (2015)


BindingDB Entry DOI: 10.7270/Q29S1PRV
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM142039
PNG
(US8927577, 118 | US8927577, 20 | US8927577, 35)
Show SMILES Cc1cc2cc(F)ccc2nc1NC(C1CC(C)(C)C1)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C27H30FN3O3/c1-16-12-19-13-21(28)8-9-22(19)30-25(16)31-24(20-14-27(2,3)15-20)17-4-6-18(7-5-17)26(34)29-11-10-23(32)33/h4-9,12-13,20,24H,10-11,14-15H2,1-3H3,(H,29,34)(H,30,31)(H,32,33)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

Article
PubMed
14n/an/an/an/an/an/an/an/a



Pfizer Inc.

Curated by ChEMBL


Assay Description
Displacement of [125I]-glucagon from human glucagon receptor expressed in Chem-1 cell membranes after 6 to 10 hrs by scintillation proximity assay


Bioorg Med Chem Lett 25: 4057-64 (2015)


Article DOI: 10.1016/j.bmcl.2015.07.092
BindingDB Entry DOI: 10.7270/Q2HM5B7N
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50433577
PNG
(CHEMBL2381848)
Show SMILES CCC[C@H](Oc1cc(C)c(c(C)c1)-n1cc(cn1)C(F)(F)F)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C26H28F3N3O4/c1-4-5-22(18-6-8-19(9-7-18)25(35)30-11-10-23(33)34)36-21-12-16(2)24(17(3)13-21)32-15-20(14-31-32)26(27,28)29/h6-9,12-15,22H,4-5,10-11H2,1-3H3,(H,30,35)(H,33,34)/t22-/s2
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
Purchase

CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
14n/an/an/an/an/an/an/an/a



Pfizer Inc.

Curated by ChEMBL


Assay Description
Displacement of [125I]-glucagon-cex from human glucagon receptor by cell based assay in presence of 0.2% bovine serum albumin


Bioorg Med Chem Lett 23: 3051-8 (2013)


Article DOI: 10.1016/j.bmcl.2013.03.014
BindingDB Entry DOI: 10.7270/Q27M099R
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM123549
PNG
(US8748624, 35)
Show SMILES OC(=O)CCNC(=O)c1ccc(cn1)-c1cc(ccc1CNc1ccc(c(Cl)c1)-c1ccc(F)c(Cl)c1)C(F)(F)F
Show InChI InChI=1S/C29H21Cl2F4N3O3/c30-23-13-20(5-6-21(23)16-2-7-25(32)24(31)11-16)37-14-17-1-4-19(29(33,34)35)12-22(17)18-3-8-26(38-15-18)28(41)36-10-9-27(39)40/h1-8,11-13,15,37H,9-10,14H2,(H,36,41)(H,39,40)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
14.4n/an/an/an/an/an/a7.4n/a



Janssen Pharmaceutica NV

US Patent


Assay Description
The binding assay was performed by a filtration method in a 384 well format. Membranes at a final protein concentration of 6 μg/well were incuba...


US Patent US8748624 (2014)


BindingDB Entry DOI: 10.7270/Q29885QP
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM123582
PNG
(US8748624, 74)
Show SMILES OC(=O)CCNC(=O)c1ccc(cn1)-c1cc(cc(Cl)c1CNc1ccc(c(Cl)c1)-c1ccc(Cl)cc1)C(F)(F)F
Show InChI InChI=1S/C29H21Cl3F3N3O3/c30-19-4-1-16(2-5-19)21-7-6-20(13-25(21)32)37-15-23-22(11-18(12-24(23)31)29(33,34)35)17-3-8-26(38-14-17)28(41)36-10-9-27(39)40/h1-8,11-14,37H,9-10,15H2,(H,36,41)(H,39,40)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
14.9n/an/an/an/an/an/a7.4n/a



Janssen Pharmaceutica NV

US Patent


Assay Description
The binding assay was performed by a filtration method in a 384 well format. Membranes at a final protein concentration of 6 μg/well were incuba...


US Patent US8748624 (2014)


BindingDB Entry DOI: 10.7270/Q29885QP
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM50119555
PNG
(CHEMBL3617571)
Show SMILES CC(C)C[C@H](Nc1ccc(cn1)C(=O)NCCC(O)=O)c1cnc(nc1)-c1ccc(cc1)C(F)(F)F
Show InChI InChI=1/C25H26F3N5O3/c1-15(2)11-20(33-21-8-5-17(12-30-21)24(36)29-10-9-22(34)35)18-13-31-23(32-14-18)16-3-6-19(7-4-16)25(26,27)28/h3-8,12-15,20H,9-11H2,1-2H3,(H,29,36)(H,30,33)(H,34,35)/t20-/s2
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Patents


Similars

Article
PubMed
15n/an/an/an/an/an/an/an/a



Pfizer Inc.

Curated by ChEMBL


Assay Description
Displacement of [125I]-glucagon from human glucagon receptor expressed in Chem-1 cell membranes after 6 to 10 hrs by scintillation proximity assay


Bioorg Med Chem Lett 25: 4057-64 (2015)


Article DOI: 10.1016/j.bmcl.2015.07.092
BindingDB Entry DOI: 10.7270/Q2HM5B7N
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM123633
PNG
(US8748624, 147)
Show SMILES OC(=O)CCNC(=O)c1ccc(cn1)-c1cc(Cl)ccc1CNc1ccc(cc1)-c1ccc(cc1Cl)C(F)(F)F
Show InChI InChI=1S/C29H22Cl2F3N3O3/c30-21-6-1-18(24(14-21)19-4-10-26(37-16-19)28(40)35-12-11-27(38)39)15-36-22-7-2-17(3-8-22)23-9-5-20(13-25(23)31)29(32,33)34/h1-10,13-14,16,36H,11-12,15H2,(H,35,40)(H,38,39)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
15.7n/an/an/an/an/an/a7.4n/a



Janssen Pharmaceutica NV

US Patent


Assay Description
The binding assay was performed by a filtration method in a 384 well format. Membranes at a final protein concentration of 6 μg/well were incuba...


US Patent US8748624 (2014)


BindingDB Entry DOI: 10.7270/Q29885QP
More data for this
Ligand-Target Pair
Glucagon


(Homo sapiens (Human))
BDBM100806
PNG
(US8507533, 114 | US8507533, 115 | US8507533, 330)
Show SMILES CC1(C)CC(C1)C(Nc1ccc(nc1)-n1cc(cn1)C(F)(F)F)c1ccc(cc1)C(=O)NCCC(O)=O
Show InChI InChI=1/C26H28F3N5O3/c1-25(2)11-18(12-25)23(16-3-5-17(6-4-16)24(37)30-10-9-22(35)36)33-20-7-8-21(31-14-20)34-15-19(13-32-34)26(27,28)29/h3-8,13-15,18,23,33H,9-12H2,1-2H3,(H,30,37)(H,35,36)
Reactome pathway
KEGG

UniProtKB/SwissProt

GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
15.8n/an/an/an/an/an/a7.4n/a



Pfizer Inc.

US Patent


Assay Description
The Glucagon SPA assay is used to determine the ability of test compounds to block the binding of glucagon-cex to the glucagon receptors.


US Patent US8507533 (2013)


BindingDB Entry DOI: 10.7270/Q23R0RGH
More data for this
Ligand-Target Pair
Glucagon-like peptide 1 receptor


(Homo sapiens (Human))
BDBM50231946
PNG
(CHEMBL4086317)
Show SMILES CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@@H]1CC(=O)NCCCC[C@H](NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc2cnc[nH]2)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O
Show InChI InChI=1/C154H232N42O45/c1-16-80(10)125(152(240)174-84(14)130(218)183-108(63-89-67-165-94-37-24-23-36-92(89)94)143(231)185-104(59-77(4)5)145(233)194-123(78(6)7)150(238)182-96(38-25-28-54-155)133(221)167-70-116(204)175-95(41-31-57-164-154(160)161)132(220)166-69-114(159)202)196-146(234)107(61-87-34-21-18-22-35-87)186-139(227)102(49-53-121(211)212)181-137(225)97(39-26-29-55-156)177-128(216)82(12)171-127(215)81(11)173-136(224)101(46-50-113(158)201)176-117(205)71-168-135(223)100(48-52-120(209)210)180-140(228)103(58-76(2)3)184-142(230)105(62-88-42-44-91(200)45-43-88)187-148(236)112(74-198)192-144(232)109-65-115(203)163-56-30-27-40-98(138(226)191-111(73-197)149(237)188-110(66-122(213)214)147(235)195-124(79(8)9)151(239)190-109)179-141(229)106(60-86-32-19-17-20-33-86)189-153(241)126(85(15)199)193-118(206)72-169-134(222)99(47-51-119(207)208)178-129(217)83(13)172-131(219)93(157)64-90-68-162-75-170-90/h17-24,32-37,42-45,67-68,75-85,93,95-112,123-126,165,197-200H,16,25-31,38-41,46-66,69-74,155-157H2,1-15H3,(H2,158,201)(H2,159,202)(H,162,170)(H,163,203)(H,166,220)(H,167,221)(H,168,223)(H,169,222)(H,171,215)(H,172,219)(H,173,224)(H,174,240)(H,175,204)(H,176,205)(H,177,216)(H,178,217)(H,179,229)(H,180,228)(H,181,225)(H,182,238)(H,183,218)(H,184,230)(H,185,231)(H,186,227)(H,187,236)(H,188,237)(H,189,241)(H,190,239)(H,191,226)(H,192,232)(H,193,206)(H,194,233)(H,195,235)(H,196,234)(H,207,208)(H,209,210)(H,211,212)(H,213,214)(H4,160,161,164)/t80-,81-,82-,83-,84-,85+,93-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,123-,124-,125-,126-/s2
PDB

UniProtKB/SwissProt

GoogleScholar
CHEMBL
PC cid
PC sid
UniChem

Similars

Article
PubMed
16n/an/an/an/an/an/an/an/a



The University of Queensland

Curated by ChEMBL


Assay Description
Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...


Eur J Med Chem 127: 703-714 (2017)


Article DOI: 10.1016/j.ejmech.2016.10.044
BindingDB Entry DOI: 10.7270/Q2T155W1
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM123637
PNG
(US8748624, 151)
Show SMILES Cc1cc(F)ccc1-c1ccc(NCc2ccc(Cl)cc2-c2ccc(nc2)C(=O)NCCC(O)=O)cc1
Show InChI InChI=1S/C29H25ClFN3O3/c1-18-14-23(31)7-10-25(18)19-3-8-24(9-4-19)33-16-20-2-6-22(30)15-26(20)21-5-11-27(34-17-21)29(37)32-13-12-28(35)36/h2-11,14-15,17,33H,12-13,16H2,1H3,(H,32,37)(H,35,36)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
16.5n/an/an/an/an/an/a7.4n/a



Janssen Pharmaceutica NV

US Patent


Assay Description
The binding assay was performed by a filtration method in a 384 well format. Membranes at a final protein concentration of 6 μg/well were incuba...


US Patent US8748624 (2014)


BindingDB Entry DOI: 10.7270/Q29885QP
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM123556
PNG
(US8748624, 42)
Show SMILES OC(=O)CCNC(=O)c1ccc(cn1)-c1cc(ccc1CNc1ccc(c(Cl)c1)-c1ccc(cc1Cl)C(F)(F)F)C(F)(F)F
Show InChI InChI=1S/C30H21Cl2F6N3O3/c31-24-12-19(30(36,37)38)4-6-21(24)22-7-5-20(13-25(22)32)40-14-16-1-3-18(29(33,34)35)11-23(16)17-2-8-26(41-15-17)28(44)39-10-9-27(42)43/h1-8,11-13,15,40H,9-10,14H2,(H,39,44)(H,42,43)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
16.5n/an/an/an/an/an/a7.4n/a



Janssen Pharmaceutica NV

US Patent


Assay Description
The binding assay was performed by a filtration method in a 384 well format. Membranes at a final protein concentration of 6 μg/well were incuba...


US Patent US8748624 (2014)


BindingDB Entry DOI: 10.7270/Q29885QP
More data for this
Ligand-Target Pair
Glucagon receptor


(Homo sapiens (Human))
BDBM123559
PNG
(US8748624, 51)
Show SMILES OC(=O)CCNC(=O)c1ccc(cn1)-c1cc(Cl)ccc1CNc1ccc(c(Cl)c1)-c1ccc(Cl)cc1Cl
Show InChI InChI=1S/C28H21Cl4N3O3/c29-18-3-1-16(23(11-18)17-2-8-26(35-15-17)28(38)33-10-9-27(36)37)14-34-20-5-7-22(25(32)13-20)21-6-4-19(30)12-24(21)31/h1-8,11-13,15,34H,9-10,14H2,(H,33,38)(H,36,37)
PDB
MMDB

UniProtKB/SwissProt

B.MOAD
GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
16.8n/an/an/an/an/an/a7.4n/a



Janssen Pharmaceutica NV

US Patent


Assay Description
The binding assay was performed by a filtration method in a 384 well format. Membranes at a final protein concentration of 6 μg/well were incuba...


US Patent US8748624 (2014)


BindingDB Entry DOI: 10.7270/Q29885QP
More data for this
Ligand-Target Pair
Glucagon


(Homo sapiens (Human))
BDBM100796
PNG
(US8507533, 101)
Show SMILES OC(=O)CCNC(=O)c1ccc(cc1)C(Nc1ccc(nc1)-n1cc(cn1)C(F)(F)F)C1CCCCC1
Show InChI InChI=1/C26H28F3N5O3/c27-26(28,29)20-14-32-34(16-20)22-11-10-21(15-31-22)33-24(17-4-2-1-3-5-17)18-6-8-19(9-7-18)25(37)30-13-12-23(35)36/h6-11,14-17,24,33H,1-5,12-13H2,(H,30,37)(H,35,36)
Reactome pathway
KEGG

UniProtKB/SwissProt

GoogleScholar
PC cid
PC sid
UniChem

Similars

US Patent
17n/an/an/an/an/an/a7.4n/a



Pfizer Inc.

US Patent


Assay Description
The Glucagon SPA assay is used to determine the ability of test compounds to block the binding of glucagon-cex to the glucagon receptors.


US Patent US8507533 (2013)


BindingDB Entry DOI: 10.7270/Q23R0RGH
More data for this
Ligand-Target Pair
Displayed 1 to 50 (of 3724 total )  |  Next  |  Last  >>
Jump to: