BindingDB logo
myBDB logout

Patent code US9394281

Compile Data Set for Download or QSAR
Found 12 hits of Enzyme Inhibition Constant Data   
Target/Host
(Institution)
LigandTarget/Host
Links
Ligand
Links
Trg + Lig
Links
Ki
nM
ΔG°
kJ/mole
IC50
nM
Kd
nM
EC50/IC50
nM
koff
s-1
kon
M-1s-1
pHTemp
°C
Tyrosine-protein kinase receptor FLT3


(Homo sapiens (Human))
BDBM236509
PNG
(US9394281, 8)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(COC34)NS(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C15H20ClN7O4S/c1-23-5-8(3-18-23)19-15-17-4-9(16)14(21-15)20-10-6-26-13-11(7-27-12(10)13)22-28(2,24)25/h3-5,10-13,22H,6-7H2,1-2H3,(H2,17,19,20,21)
PDB
MMDB

KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 11n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
FLT3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 50 μM EAIYAAPFAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx. 500...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM236509
PNG
(US9394281, 8)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(COC34)NS(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C15H20ClN7O4S/c1-23-5-8(3-18-23)19-15-17-4-9(16)14(21-15)20-10-6-26-13-11(7-27-12(10)13)22-28(2,24)25/h3-5,10-13,22H,6-7H2,1-2H3,(H2,17,19,20,21)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 31n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Aurora kinase B/Inner centromere protein


(Homo sapiens (Human))
BDBM236509
PNG
(US9394281, 8)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(COC34)NS(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C15H20ClN7O4S/c1-23-5-8(3-18-23)19-15-17-4-9(16)14(21-15)20-10-6-26-13-11(7-27-12(10)13)22-28(2,24)25/h3-5,10-13,22H,6-7H2,1-2H3,(H2,17,19,20,21)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 31n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
Aurora-B (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 30 μM AKRRRLSSLRA, 10 mM MgAcetate and [γ-33PATP](specific activity approx. 5...


Citation and Details
More data for this
Ligand-Target Pair
Aurora kinase B/Inner centromere protein


(Homo sapiens (Human))
BDBM236507
PNG
(US9394281, 5)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(COC34)OCCO)n2)cn1
Show InChI InChI=1S/C16H21ClN6O4/c1-23-6-9(4-19-23)20-16-18-5-10(17)15(22-16)21-11-7-26-14-12(25-3-2-24)8-27-13(11)14/h4-6,11-14,24H,2-3,7-8H2,1H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 50n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
Aurora-B (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 30 μM AKRRRLSSLRA, 10 mM MgAcetate and [γ-33PATP](specific activity approx. 5...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM236509
PNG
(US9394281, 8)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(COC34)NS(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C15H20ClN7O4S/c1-23-5-8(3-18-23)19-15-17-4-9(16)14(21-15)20-10-6-26-13-11(7-27-12(10)13)22-28(2,24)25/h3-5,10-13,22H,6-7H2,1-2H3,(H2,17,19,20,21)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 51n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase receptor FLT3


(Homo sapiens (Human))
BDBM236507
PNG
(US9394281, 5)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(COC34)OCCO)n2)cn1
Show InChI InChI=1S/C16H21ClN6O4/c1-23-6-9(4-19-23)20-16-18-5-10(17)15(22-16)21-11-7-26-14-12(25-3-2-24)8-27-13(11)14/h4-6,11-14,24H,2-3,7-8H2,1H3,(H2,18,20,21,22)
PDB
MMDB

KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 57n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
FLT3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 50 μM EAIYAAPFAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx. 500...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM236507
PNG
(US9394281, 5)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(COC34)OCCO)n2)cn1
Show InChI InChI=1S/C16H21ClN6O4/c1-23-6-9(4-19-23)20-16-18-5-10(17)15(22-16)21-11-7-26-14-12(25-3-2-24)8-27-13(11)14/h4-6,11-14,24H,2-3,7-8H2,1H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 61n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM236507
PNG
(US9394281, 5)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(COC34)OCCO)n2)cn1
Show InChI InChI=1S/C16H21ClN6O4/c1-23-6-9(4-19-23)20-16-18-5-10(17)15(22-16)21-11-7-26-14-12(25-3-2-24)8-27-13(11)14/h4-6,11-14,24H,2-3,7-8H2,1H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 68n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM236506
PNG
(US9394281, 3)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1COC2C(O)COC12
Show InChI InChI=1S/C15H20N6O3/c1-8-3-16-15(18-9-4-17-21(2)5-9)20-14(8)19-10-6-23-13-11(22)7-24-12(10)13/h3-5,10-13,22H,6-7H2,1-2H3,(H2,16,18,19,20)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 78n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM236508
PNG
(US9394281, 7)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3COC4C(N)COC34)n2)cn1
Show InChI InChI=1S/C14H18ClN7O2/c1-22-4-7(2-18-22)19-14-17-3-8(15)13(21-14)20-10-6-24-11-9(16)5-23-12(10)11/h2-4,9-12H,5-6,16H2,1H3,(H2,17,19,20,21)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 99n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM236505
PNG
(US9394281, 1)
Show SMILES CN(C1COC2C(O)COC12)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C15H19ClN6O3/c1-21-5-8(3-18-21)19-15-17-4-9(16)14(20-15)22(2)10-6-24-13-11(23)7-25-12(10)13/h3-5,10-13,23H,6-7H2,1-2H3,(H,17,19,20)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 261n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM236505
PNG
(US9394281, 1)
Show SMILES CN(C1COC2C(O)COC12)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C15H19ClN6O3/c1-21-5-8(3-18-21)19-15-17-4-9(16)14(20-15)22(2)10-6-24-13-11(23)7-25-12(10)13/h3-5,10-13,23H,6-7H2,1-2H3,(H,17,19,20)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 689n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP] (...


Citation and Details
More data for this
Ligand-Target Pair
* indicates data uncertainty>20%