BindingDB logo
myBDB logout

Patent code US9403801

Compile Data Set for Download or QSAR
Found 81 hits of Enzyme Inhibition Constant Data   
Target/Host
(Institution)
LigandTarget/Host
Links
Ligand
Links
Trg + Lig
Links
Ki
nM
ΔG°
kJ/mole
IC50
nM
Kd
nM
EC50/IC50
nM
koff
s-1
kon
M-1s-1
pHTemp
°C
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239977
PNG
(US9403801, 48)
Show SMILES Clc1cnc(Nc2cnn(CC3CC3)c2)nc1NC1CCC2(CC1)CCN(CC2)C(=O)CC#N
Show InChI InChI=1S/C24H31ClN8O/c25-20-14-27-23(30-19-13-28-33(16-19)15-17-1-2-17)31-22(20)29-18-3-6-24(7-4-18)8-11-32(12-9-24)21(34)5-10-26/h13-14,16-18H,1-9,11-12,15H2,(H2,27,29,30,31)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 0.400n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239968
PNG
(US9403801, 33)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)c3ccc(cn3)C#N)n2)cn1
Show InChI InChI=1S/C21H22ClN9/c1-30-12-17(8-26-30)28-21-25-9-18(22)20(29-21)27-16-4-14-10-31(11-15(14)5-16)19-3-2-13(6-23)7-24-19/h2-3,7-9,12,14-16H,4-5,10-11H2,1H3,(H2,25,27,28,29)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 0.400n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239976
PNG
(US9403801, 46)
Show SMILES Clc1cnc(Nc2cnn(CC3CC3)c2)nc1NC1CC2CN(CC2C1)C(=O)CC#N
Show InChI InChI=1S/C21H25ClN8O/c22-18-8-24-21(27-17-7-25-30(12-17)9-13-1-2-13)28-20(18)26-16-5-14-10-29(11-15(14)6-16)19(31)3-4-23/h7-8,12-16H,1-3,5-6,9-11H2,(H2,24,26,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 0.5n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239955
PNG
(US9403801, 14A | US9403801, 14B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCN(C4)C(=O)CC#N)CC3)n2)cn1
Show InChI InChI=1S/C20H25ClN8O/c1-28-12-15(10-24-28)26-19-23-11-16(21)18(27-19)25-14-2-5-20(6-3-14)7-9-29(13-20)17(30)4-8-22/h10-12,14H,2-7,9,13H2,1H3,(H2,23,25,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 0.800n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239965
PNG
(US9403801, 30)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)C(F)(F)F)n2)cn1
Show InChI InChI=1S/C20H25ClF3N7O/c1-30-12-14(10-26-30)28-18-25-11-15(21)16(29-18)27-13-2-4-19(5-3-13)6-8-31(9-7-19)17(32)20(22,23)24/h10-13H,2-9H2,1H3,(H2,25,27,28,29)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 0.900n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239963
PNG
(US9403801, 28)
Show SMILES CC(=O)N1CCC2(CCC(CC2)Nc2nc(Nc3cnn(C)c3)ncc2Cl)CC1
Show InChI InChI=1S/C20H28ClN7O/c1-14(29)28-9-7-20(8-10-28)5-3-15(4-6-20)24-18-17(21)12-22-19(26-18)25-16-11-23-27(2)13-16/h11-13,15H,3-10H2,1-2H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 0.900n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239953
PNG
(US9403801, 12)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C18H21ClN8O/c1-26-10-14(6-22-26)24-18-21-7-15(19)17(25-18)23-13-4-11-8-27(9-12(11)5-13)16(28)2-3-20/h6-7,10-13H,2,4-5,8-9H2,1H3,(H2,21,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 1n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Non-receptor tyrosine-protein kinase TYK2


(Homo sapiens (Human))
BDBM239955
PNG
(US9403801, 14A | US9403801, 14B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCN(C4)C(=O)CC#N)CC3)n2)cn1
Show InChI InChI=1S/C20H25ClN8O/c1-28-12-15(10-24-28)26-19-23-11-16(21)18(27-19)25-14-2-5-20(6-3-14)7-9-29(13-20)17(30)4-8-22/h10-12,14H,2-7,9,13H2,1H3,(H2,23,25,26,27)
PDB

KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 1n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239966
PNG
(US9403801, 31)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)S(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C16H22ClN7O2S/c1-23-9-13(5-19-23)21-16-18-6-14(17)15(22-16)20-12-3-10-7-24(27(2,25)26)8-11(10)4-12/h5-6,9-12H,3-4,7-8H2,1-2H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 1n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239981
PNG
(US9403801, 59)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1CC2CN(CC2C1)c1ccc(cn1)C#N
Show InChI InChI=1S/C22H25N9/c1-14-8-25-22(28-19-10-26-30(2)13-19)29-21(14)27-18-5-16-11-31(12-17(16)6-18)20-4-3-15(7-23)9-24-20/h3-4,8-10,13,16-18H,5-6,11-12H2,1-2H3,(H2,25,27,28,29)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 1n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239958
PNG
(US9403801, 22)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4CN(CC4C3)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C19H23ClN8O/c1-27-11-15(7-23-27)25-19-22-8-16(20)18(26-19)24-14-3-2-12-9-28(10-13(12)6-14)17(29)4-5-21/h7-8,11-14H,2-4,6,9-10H2,1H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239964
PNG
(US9403801, 29)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)S(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C19H28ClN7O2S/c1-26-13-15(11-22-26)24-18-21-12-16(20)17(25-18)23-14-3-5-19(6-4-14)7-9-27(10-8-19)30(2,28)29/h11-14H,3-10H2,1-2H3,(H2,21,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239955
PNG
(US9403801, 14A | US9403801, 14B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCN(C4)C(=O)CC#N)CC3)n2)cn1
Show InChI InChI=1S/C20H25ClN8O/c1-28-12-15(10-24-28)26-19-23-11-16(21)18(27-19)25-14-2-5-20(6-3-14)7-9-29(13-20)17(30)4-8-22/h10-12,14H,2-7,9,13H2,1H3,(H2,23,25,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239969
PNG
(US9403801, 34)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)C(F)(F)F)n2)cn1
Show InChI InChI=1S/C17H19ClF3N7O/c1-27-8-12(4-23-27)25-16-22-5-13(18)14(26-16)24-11-2-9-6-28(7-10(9)3-11)15(29)17(19,20)21/h4-5,8-11H,2-3,6-7H2,1H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239961
PNG
(US9403801, 26)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C21H27ClN8O/c1-29-14-16(12-25-29)27-20-24-13-17(22)19(28-20)26-15-2-5-21(6-3-15)7-10-30(11-8-21)18(31)4-9-23/h12-15H,2-8,10-11H2,1H3,(H2,24,26,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239985
PNG
(US9403801, 64)
Show SMILES Cc1nn(C)cc1Nc1ncc(Cl)c(NC2CC3CN(CC3C2)C(=O)CC#N)n1
Show InChI InChI=1S/C19H23ClN8O/c1-11-16(10-27(2)26-11)24-19-22-7-15(20)18(25-19)23-14-5-12-8-28(9-13(12)6-14)17(29)3-4-21/h7,10,12-14H,3,5-6,8-9H2,1-2H3,(H2,22,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239970
PNG
(US9403801, 35)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC(F)(F)F)CC4C3)n2)cn1
Show InChI InChI=1S/C17H21ClF3N7/c1-27-8-13(4-23-27)25-16-22-5-14(18)15(26-16)24-12-2-10-6-28(7-11(10)3-12)9-17(19,20)21/h4-5,8,10-12H,2-3,6-7,9H2,1H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239954
PNG
(US9403801, 13.3A | US9403801, 13.3B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCNC4)CC3)n2)cn1
Show InChI InChI=1S/C17H24ClN7/c1-25-10-13(8-21-25)23-16-20-9-14(18)15(24-16)22-12-2-4-17(5-3-12)6-7-19-11-17/h8-10,12,19H,2-7,11H2,1H3,(H2,20,22,23,24)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239954
PNG
(US9403801, 13.3A | US9403801, 13.3B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCNC4)CC3)n2)cn1
Show InChI InChI=1S/C17H24ClN7/c1-25-10-13(8-21-25)23-16-20-9-14(18)15(24-16)22-12-2-4-17(5-3-12)6-7-19-11-17/h8-10,12,19H,2-7,11H2,1H3,(H2,20,22,23,24)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 2n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239968
PNG
(US9403801, 33)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)c3ccc(cn3)C#N)n2)cn1
Show InChI InChI=1S/C21H22ClN9/c1-30-12-17(8-26-30)28-21-25-9-18(22)20(29-21)27-16-4-14-10-31(11-15(14)5-16)19-3-2-13(6-23)7-24-19/h2-3,7-9,12,14-16H,4-5,10-11H2,1H3,(H2,25,27,28,29)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 3n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239974
PNG
(US9403801, 42)
Show SMILES Cn1cnc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)CC#N)n2)c1
Show InChI InChI=1S/C21H27ClN8O/c1-29-13-17(25-14-29)27-20-24-12-16(22)19(28-20)26-15-2-5-21(6-3-15)7-10-30(11-8-21)18(31)4-9-23/h12-15H,2-8,10-11H2,1H3,(H2,24,26,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 3n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239957
PNG
(US9403801, 20)
Show SMILES CN(C1CCC2(C1)CCCN(C2)C(=O)CC#N)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C21H27ClN8O/c1-28-13-15(11-25-28)26-20-24-12-17(22)19(27-20)29(2)16-4-7-21(10-16)6-3-9-30(14-21)18(31)5-8-23/h11-13,16H,3-7,9-10,14H2,1-2H3,(H,24,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 3n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239967
PNG
(US9403801, 32)
Show SMILES CC(=O)N1CC2CC(CC2C1)Nc1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C17H22ClN7O/c1-10(26)25-7-11-3-13(4-12(11)8-25)21-16-15(18)6-19-17(23-16)22-14-5-20-24(2)9-14/h5-6,9,11-13H,3-4,7-8H2,1-2H3,(H2,19,21,22,23)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 3n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239984
PNG
(US9403801, 62)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1CC2CN(CC2C1)S(C)(=O)=O
Show InChI InChI=1S/C17H25N7O2S/c1-11-6-18-17(21-15-7-19-23(2)10-15)22-16(11)20-14-4-12-8-24(27(3,25)26)9-13(12)5-14/h6-7,10,12-14H,4-5,8-9H2,1-3H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 4n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239962
PNG
(US9403801, 27)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)c3ccc(cn3)C#N)n2)cn1
Show InChI InChI=1S/C24H28ClN9/c1-33-16-19(14-29-33)31-23-28-15-20(25)22(32-23)30-18-4-6-24(7-5-18)8-10-34(11-9-24)21-3-2-17(12-26)13-27-21/h2-3,13-16,18H,4-11H2,1H3,(H2,28,30,31,32)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 4n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Serine/threonine-protein kinase Aurora


(Homo sapiens (human))
BDBM239966
PNG
(US9403801, 31)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)S(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C16H22ClN7O2S/c1-23-9-13(5-19-23)21-16-18-6-14(17)15(22-16)20-12-3-10-7-24(27(2,25)26)8-11(10)4-12/h5-6,9-12H,3-4,7-8H2,1-2H3,(H2,18,20,21,22)
PDB
MMDB

NCI pathway
Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 4n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...


Citation and Details
More data for this
Ligand-Target Pair
Non-receptor tyrosine-protein kinase TYK2


(Homo sapiens (Human))
BDBM239963
PNG
(US9403801, 28)
Show SMILES CC(=O)N1CCC2(CCC(CC2)Nc2nc(Nc3cnn(C)c3)ncc2Cl)CC1
Show InChI InChI=1S/C20H28ClN7O/c1-14(29)28-9-7-20(8-10-28)5-3-15(4-6-20)24-18-17(21)12-22-19(26-18)25-16-11-23-27(2)13-16/h11-13,15H,3-10H2,1-2H3,(H2,22,24,25,26)
PDB

KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 4n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239963
PNG
(US9403801, 28)
Show SMILES CC(=O)N1CCC2(CCC(CC2)Nc2nc(Nc3cnn(C)c3)ncc2Cl)CC1
Show InChI InChI=1S/C20H28ClN7O/c1-14(29)28-9-7-20(8-10-28)5-3-15(4-6-20)24-18-17(21)12-22-19(26-18)25-16-11-23-27(2)13-16/h11-13,15H,3-10H2,1-2H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 4n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239971
PNG
(US9403801, 37)
Show SMILES Cc1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)CC#N)n2)nn1C
Show InChI InChI=1S/C22H29ClN8O/c1-15-13-18(29-30(15)2)27-21-25-14-17(23)20(28-21)26-16-3-6-22(7-4-16)8-11-31(12-9-22)19(32)5-10-24/h13-14,16H,3-9,11-12H2,1-2H3,(H2,25,26,27,28,29)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 5n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239979
PNG
(US9403801, 56)
Show SMILES Cn1nc(cc1Nc1ncc(Cl)c(NC2CC3CN(CC3C2)C(=O)CC#N)n1)C1CC1
Show InChI InChI=1S/C21H25ClN8O/c1-29-18(8-17(28-29)12-2-3-12)26-21-24-9-16(22)20(27-21)25-15-6-13-10-30(11-14(13)7-15)19(31)4-5-23/h8-9,12-15H,2-4,6-7,10-11H2,1H3,(H2,24,25,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 5n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239964
PNG
(US9403801, 29)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)S(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C19H28ClN7O2S/c1-26-13-15(11-22-26)24-18-21-12-16(20)17(25-18)23-14-3-5-19(6-4-14)7-9-27(10-8-19)30(2,28)29/h11-14H,3-10H2,1-2H3,(H2,21,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 5n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239972
PNG
(US9403801, 39)
Show SMILES Cc1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)nn1C
Show InChI InChI=1S/C19H23ClN8O/c1-11-5-16(26-27(11)2)24-19-22-8-15(20)18(25-19)23-14-6-12-9-28(10-13(12)7-14)17(29)3-4-21/h5,8,12-14H,3,6-7,9-10H2,1-2H3,(H2,22,23,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 5n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239955
PNG
(US9403801, 14A | US9403801, 14B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCN(C4)C(=O)CC#N)CC3)n2)cn1
Show InChI InChI=1S/C20H25ClN8O/c1-28-12-15(10-24-28)26-19-23-11-16(21)18(27-19)25-14-2-5-20(6-3-14)7-9-29(13-20)17(30)4-8-22/h10-12,14H,2-7,9,13H2,1H3,(H2,23,25,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 5n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239965
PNG
(US9403801, 30)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)C(F)(F)F)n2)cn1
Show InChI InChI=1S/C20H25ClF3N7O/c1-30-12-14(10-26-30)28-18-25-11-15(21)16(29-18)27-13-2-4-19(5-3-13)6-8-31(9-7-19)17(32)20(22,23)24/h10-13H,2-9H2,1H3,(H2,25,27,28,29)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 5n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239982
PNG
(US9403801, 60)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1CC2CN(CC2C1)C(=O)CC#N
Show InChI InChI=1S/C19H24N8O/c1-12-7-21-19(24-16-8-22-26(2)11-16)25-18(12)23-15-5-13-9-27(10-14(13)6-15)17(28)3-4-20/h7-8,11,13-15H,3,5-6,9-10H2,1-2H3,(H2,21,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 5n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239958
PNG
(US9403801, 22)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4CN(CC4C3)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C19H23ClN8O/c1-27-11-15(7-23-27)25-19-22-8-16(20)18(26-19)24-14-3-2-12-9-28(10-13(12)6-14)17(29)4-5-21/h7-8,11-14H,2-4,6,9-10H2,1H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 6n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239961
PNG
(US9403801, 26)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C21H27ClN8O/c1-29-14-16(12-25-29)27-20-24-13-17(22)19(28-20)26-15-2-5-21(6-3-15)7-10-30(11-8-21)18(31)4-9-23/h12-15H,2-8,10-11H2,1H3,(H2,24,26,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 6n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239960
PNG
(US9403801, 25)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1CCC2(CC1)CCN(CC2)C(=O)CC#N
Show InChI InChI=1S/C22H30N8O/c1-16-13-24-21(27-18-14-25-29(2)15-18)28-20(16)26-17-3-6-22(7-4-17)8-11-30(12-9-22)19(31)5-10-23/h13-15,17H,3-9,11-12H2,1-2H3,(H2,24,26,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 6n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239986
PNG
(US9403801, 66)
Show SMILES Cc1c(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)cnn1C
Show InChI InChI=1S/C19H23ClN8O/c1-11-16(8-23-27(11)2)25-19-22-7-15(20)18(26-19)24-14-5-12-9-28(10-13(12)6-14)17(29)3-4-21/h7-8,12-14H,3,5-6,9-10H2,1-2H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 7n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239957
PNG
(US9403801, 20)
Show SMILES CN(C1CCC2(C1)CCCN(C2)C(=O)CC#N)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C21H27ClN8O/c1-28-13-15(11-25-28)26-20-24-12-17(22)19(27-20)29(2)16-4-7-21(10-16)6-3-9-30(14-21)18(31)5-8-23/h11-13,16H,3-7,9-10,14H2,1-2H3,(H,24,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 7n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239956
PNG
(US9403801, 18)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CN(CC33CCCC3)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C19H23ClN8O/c1-27-10-13(8-23-27)24-18-22-9-14(20)17(26-18)25-15-11-28(16(29)4-7-21)12-19(15)5-2-3-6-19/h8-10,15H,2-6,11-12H2,1H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 7n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239951
PNG
(US9403801, 10)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1CCC2(CCN(C2)C(=O)CC#N)CC1
Show InChI InChI=1S/C21H28N8O/c1-15-11-23-20(26-17-12-24-28(2)13-17)27-19(15)25-16-3-6-21(7-4-16)8-10-29(14-21)18(30)5-9-22/h11-13,16H,3-8,10,14H2,1-2H3,(H2,23,25,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 7n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Non-receptor tyrosine-protein kinase TYK2


(Homo sapiens (Human))
BDBM239953
PNG
(US9403801, 12)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C18H21ClN8O/c1-26-10-14(6-22-26)24-18-21-7-15(19)17(25-18)23-13-4-11-8-27(9-12(11)5-13)16(28)2-3-20/h6-7,10-13H,2,4-5,8-9H2,1H3,(H2,21,23,24,25)
PDB

KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 7n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239970
PNG
(US9403801, 35)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC(F)(F)F)CC4C3)n2)cn1
Show InChI InChI=1S/C17H21ClF3N7/c1-27-8-13(4-23-27)25-16-22-5-14(18)15(26-16)24-12-2-10-6-28(7-11(10)3-12)9-17(19,20)21/h4-5,8,10-12H,2-3,6-7,9H2,1H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 8n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239950
PNG
(US9403801, 8)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1CN(CC11CCCC1)C(=O)CC#N
Show InChI InChI=1S/C20H26N8O/c1-14-9-22-19(24-15-10-23-27(2)11-15)26-18(14)25-16-12-28(17(29)5-8-21)13-20(16)6-3-4-7-20/h9-11,16H,3-7,12-13H2,1-2H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 11n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239971
PNG
(US9403801, 37)
Show SMILES Cc1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)CC#N)n2)nn1C
Show InChI InChI=1S/C22H29ClN8O/c1-15-13-18(29-30(15)2)27-21-25-14-17(23)20(28-21)26-16-3-6-22(7-4-16)8-11-31(12-9-22)19(32)5-10-24/h13-14,16H,3-9,11-12H2,1-2H3,(H2,25,26,27,28,29)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 11n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239974
PNG
(US9403801, 42)
Show SMILES Cn1cnc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)CC#N)n2)c1
Show InChI InChI=1S/C21H27ClN8O/c1-29-13-17(25-14-29)27-20-24-12-16(22)19(28-20)26-15-2-5-21(6-3-15)7-10-30(11-8-21)18(31)4-9-23/h12-15H,2-8,10-11H2,1H3,(H2,24,26,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 12n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239966
PNG
(US9403801, 31)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)S(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C16H22ClN7O2S/c1-23-9-13(5-19-23)21-16-18-6-14(17)15(22-16)20-12-3-10-7-24(27(2,25)26)8-11(10)4-12/h5-6,9-12H,3-4,7-8H2,1-2H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 12n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239954
PNG
(US9403801, 13.3A | US9403801, 13.3B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCNC4)CC3)n2)cn1
Show InChI InChI=1S/C17H24ClN7/c1-25-10-13(8-21-25)23-16-20-9-14(18)15(24-16)22-12-2-4-17(5-3-12)6-7-19-11-17/h8-10,12,19H,2-7,11H2,1H3,(H2,20,22,23,24)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 14n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239978
PNG
(US9403801, 50)
Show SMILES OCCn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C22H29ClN8O2/c23-18-14-25-21(28-17-13-26-31(15-17)11-12-32)29-20(18)27-16-1-4-22(5-2-16)6-9-30(10-7-22)19(33)3-8-24/h13-16,32H,1-7,9-12H2,(H2,25,27,28,29)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 14n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239955
PNG
(US9403801, 14A | US9403801, 14B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCN(C4)C(=O)CC#N)CC3)n2)cn1
Show InChI InChI=1S/C20H25ClN8O/c1-28-12-15(10-24-28)26-19-23-11-16(21)18(27-19)25-14-2-5-20(6-3-14)7-9-29(13-20)17(30)4-8-22/h10-12,14H,2-7,9,13H2,1H3,(H2,23,25,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 15n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239987
PNG
(US9403801, 69)
Show SMILES CN(C1CC2CN(CC2C1)C(=O)CC#N)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C19H23ClN8O/c1-26-11-14(7-23-26)24-19-22-8-16(20)18(25-19)27(2)15-5-12-9-28(10-13(12)6-15)17(29)3-4-21/h7-8,11-13,15H,3,5-6,9-10H2,1-2H3,(H,22,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 15n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase receptor FLT3


(Homo sapiens (Human))
BDBM239963
PNG
(US9403801, 28)
Show SMILES CC(=O)N1CCC2(CCC(CC2)Nc2nc(Nc3cnn(C)c3)ncc2Cl)CC1
Show InChI InChI=1S/C20H28ClN7O/c1-14(29)28-9-7-20(8-10-28)5-3-15(4-6-20)24-18-17(21)12-22-19(26-18)25-16-11-23-27(2)13-16/h11-13,15H,3-10H2,1-2H3,(H2,22,24,25,26)
PDB
MMDB

KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 16n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
FLT3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 50 μM EAIYAAPFAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx. 500...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239980
PNG
(US9403801, 57)
Show SMILES Cc1nn(C)cc1Nc1ncc(Cl)c(NC2CCC3(CC2)CCN(CC3)C(=O)CC#N)n1
Show InChI InChI=1S/C22H29ClN8O/c1-15-18(14-30(2)29-15)27-21-25-13-17(23)20(28-21)26-16-3-6-22(7-4-16)8-11-31(12-9-22)19(32)5-10-24/h13-14,16H,3-9,11-12H2,1-2H3,(H2,25,26,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 16n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239969
PNG
(US9403801, 34)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)C(F)(F)F)n2)cn1
Show InChI InChI=1S/C17H19ClF3N7O/c1-27-8-12(4-23-27)25-16-22-5-13(18)14(26-16)24-11-2-9-6-28(7-10(9)3-11)15(29)17(19,20)21/h4-5,8-11H,2-3,6-7H2,1H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 17n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239953
PNG
(US9403801, 12)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C18H21ClN8O/c1-26-10-14(6-22-26)24-18-21-7-15(19)17(25-18)23-13-4-11-8-27(9-12(11)5-13)16(28)2-3-20/h6-7,10-13H,2,4-5,8-9H2,1H3,(H2,21,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 18n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Non-receptor tyrosine-protein kinase TYK2


(Homo sapiens (Human))
BDBM239966
PNG
(US9403801, 31)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)S(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C16H22ClN7O2S/c1-23-9-13(5-19-23)21-16-18-6-14(17)15(22-16)20-12-3-10-7-24(27(2,25)26)8-11(10)4-12/h5-6,9-12H,3-4,7-8H2,1-2H3,(H2,18,20,21,22)
PDB

KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 18n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239959
PNG
(US9403801, 24)
Show SMILES CN(C1CCC2(CC1)CCN(CC2)C(=O)CC#N)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C22H29ClN8O/c1-29-15-16(13-26-29)27-21-25-14-18(23)20(28-21)30(2)17-3-6-22(7-4-17)8-11-31(12-9-22)19(32)5-10-24/h13-15,17H,3-9,11-12H2,1-2H3,(H,25,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 19n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239973
PNG
(US9403801, 41)
Show SMILES Cn1cnc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)c1
Show InChI InChI=1S/C18H21ClN8O/c1-26-9-15(22-10-26)24-18-21-6-14(19)17(25-18)23-13-4-11-7-27(8-12(11)5-13)16(28)2-3-20/h6,9-13H,2,4-5,7-8H2,1H3,(H2,21,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 20n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239948
PNG
(US9403801, 4A)
Show SMILES CN(C1CCC2(CCN(C2)C(=O)CC#N)CC1)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C21H27ClN8O/c1-28-13-15(11-25-28)26-20-24-12-17(22)19(27-20)29(2)16-3-6-21(7-4-16)8-10-30(14-21)18(31)5-9-23/h11-13,16H,3-8,10,14H2,1-2H3,(H,24,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 20n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Serine/threonine-protein kinase Aurora


(Homo sapiens (human))
BDBM239963
PNG
(US9403801, 28)
Show SMILES CC(=O)N1CCC2(CCC(CC2)Nc2nc(Nc3cnn(C)c3)ncc2Cl)CC1
Show InChI InChI=1S/C20H28ClN7O/c1-14(29)28-9-7-20(8-10-28)5-3-15(4-6-20)24-18-17(21)12-22-19(26-18)25-16-11-23-27(2)13-16/h11-13,15H,3-10H2,1-2H3,(H2,22,24,25,26)
PDB
MMDB

NCI pathway
Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 22n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239962
PNG
(US9403801, 27)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)c3ccc(cn3)C#N)n2)cn1
Show InChI InChI=1S/C24H28ClN9/c1-33-16-19(14-29-33)31-23-28-15-20(25)22(32-23)30-18-4-6-24(7-5-18)8-10-34(11-9-24)21-3-2-17(12-26)13-27-21/h2-3,13-16,18H,4-11H2,1H3,(H2,28,30,31,32)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 23n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239952
PNG
(US9403801, 11)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CNCC4C3)n2)cn1
Show InChI InChI=1S/C15H20ClN7/c1-23-8-12(6-19-23)21-15-18-7-13(16)14(22-15)20-11-2-9-4-17-5-10(9)3-11/h6-11,17H,2-5H2,1H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 27n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239972
PNG
(US9403801, 39)
Show SMILES Cc1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)nn1C
Show InChI InChI=1S/C19H23ClN8O/c1-11-5-16(26-27(11)2)24-19-22-8-15(20)18(25-19)23-14-6-12-9-28(10-13(12)7-14)17(29)3-4-21/h5,8,12-14H,3,6-7,9-10H2,1-2H3,(H2,22,23,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 30n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239967
PNG
(US9403801, 32)
Show SMILES CC(=O)N1CC2CC(CC2C1)Nc1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C17H22ClN7O/c1-10(26)25-7-11-3-13(4-12(11)8-25)21-16-15(18)6-19-17(23-16)22-14-5-20-24(2)9-14/h5-6,9,11-13H,3-4,7-8H2,1-2H3,(H2,19,21,22,23)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 37n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK3


(Homo sapiens (Human))
BDBM239955
PNG
(US9403801, 14A | US9403801, 14B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCN(C4)C(=O)CC#N)CC3)n2)cn1
Show InChI InChI=1S/C20H25ClN8O/c1-28-12-15(10-24-28)26-19-23-11-16(21)18(27-19)25-14-2-5-20(6-3-14)7-9-29(13-20)17(30)4-8-22/h10-12,14H,2-7,9,13H2,1H3,(H2,23,25,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 39n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx....


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239959
PNG
(US9403801, 24)
Show SMILES CN(C1CCC2(CC1)CCN(CC2)C(=O)CC#N)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C22H29ClN8O/c1-29-15-16(13-26-29)27-21-25-14-18(23)20(28-21)30(2)17-3-6-22(7-4-17)8-11-31(12-9-22)19(32)5-10-24/h13-15,17H,3-9,11-12H2,1-2H3,(H,25,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 39n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239987
PNG
(US9403801, 69)
Show SMILES CN(C1CC2CN(CC2C1)C(=O)CC#N)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C19H23ClN8O/c1-26-11-14(7-23-26)24-19-22-8-16(20)18(25-19)27(2)15-5-12-9-28(10-13(12)6-15)17(29)3-4-21/h7-8,11-13,15H,3,5-6,9-10H2,1-2H3,(H,22,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 41n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239983
PNG
(US9403801, 61)
Show SMILES CC(=O)N1CC2CC(CC2C1)Nc1nc(Nc2cnn(C)c2)ncc1C
Show InChI InChI=1S/C18H25N7O/c1-11-6-19-18(22-16-7-20-24(3)10-16)23-17(11)21-15-4-13-8-25(12(2)26)9-14(13)5-15/h6-7,10,13-15H,4-5,8-9H2,1-3H3,(H2,19,21,22,23)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 42n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK3


(Homo sapiens (Human))
BDBM239963
PNG
(US9403801, 28)
Show SMILES CC(=O)N1CCC2(CCC(CC2)Nc2nc(Nc3cnn(C)c3)ncc2Cl)CC1
Show InChI InChI=1S/C20H28ClN7O/c1-14(29)28-9-7-20(8-10-28)5-3-15(4-6-20)24-18-17(21)12-22-19(26-18)25-16-11-23-27(2)13-16/h11-13,15H,3-10H2,1-2H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 47n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx....


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239954
PNG
(US9403801, 13.3A | US9403801, 13.3B)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCNC4)CC3)n2)cn1
Show InChI InChI=1S/C17H24ClN7/c1-25-10-13(8-21-25)23-16-20-9-14(18)15(24-16)22-12-2-4-17(5-3-12)6-7-19-11-17/h8-10,12,19H,2-7,11H2,1H3,(H2,20,22,23,24)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 55n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239949
PNG
(US9403801, 6)
Show SMILES Cn1cc(Nc2nccc(NC3CCC4(CCN(C4)C(=O)CC#N)CC3)n2)cn1
Show InChI InChI=1S/C20H26N8O/c1-27-13-16(12-23-27)25-19-22-10-5-17(26-19)24-15-2-6-20(7-3-15)8-11-28(14-20)18(29)4-9-21/h5,10,12-13,15H,2-4,6-8,11,14H2,1H3,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 55n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK1


(Homo sapiens (Human))
BDBM239975
PNG
(US9403801, 44)
Show SMILES OCCn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C19H23ClN8O2/c20-16-8-22-19(25-15-7-23-28(11-15)3-4-29)26-18(16)24-14-5-12-9-27(10-13(12)6-14)17(30)1-2-21/h7-8,11-14,29H,1,3-6,9-10H2,(H2,22,24,25,26)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 57n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239948
PNG
(US9403801, 4A)
Show SMILES CN(C1CCC2(CCN(C2)C(=O)CC#N)CC1)c1nc(Nc2cnn(C)c2)ncc1Cl
Show InChI InChI=1S/C21H27ClN8O/c1-28-13-15(11-25-28)26-20-24-12-17(22)19(27-20)29(2)16-3-6-21(7-4-16)8-10-30(14-21)18(31)5-9-23/h11-13,16H,3-8,10,14H2,1-2H3,(H,24,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 83n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239960
PNG
(US9403801, 25)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1CCC2(CC1)CCN(CC2)C(=O)CC#N
Show InChI InChI=1S/C22H30N8O/c1-16-13-24-21(27-18-14-25-29(2)15-18)28-20(16)26-17-3-6-22(7-4-17)8-11-30(12-9-22)19(31)5-10-23/h13-15,17H,3-9,11-12H2,1-2H3,(H2,24,26,27,28)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 86n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239951
PNG
(US9403801, 10)
Show SMILES Cc1cnc(Nc2cnn(C)c2)nc1NC1CCC2(CCN(C2)C(=O)CC#N)CC1
Show InChI InChI=1S/C21H28N8O/c1-15-11-23-20(26-17-12-24-28(2)13-17)27-19(15)25-16-3-6-21(7-4-16)8-10-29(14-21)18(30)5-9-22/h11-13,16H,3-8,10,14H2,1-2H3,(H2,23,25,26,27)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 129n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase receptor FLT3


(Homo sapiens (Human))
BDBM239966
PNG
(US9403801, 31)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)S(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C16H22ClN7O2S/c1-23-9-13(5-19-23)21-16-18-6-14(17)15(22-16)20-12-3-10-7-24(27(2,25)26)8-11(10)4-12/h5-6,9-12H,3-4,7-8H2,1-2H3,(H2,18,20,21,22)
PDB
MMDB

KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 134n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
FLT3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 50 μM EAIYAAPFAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx. 500...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239952
PNG
(US9403801, 11)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CNCC4C3)n2)cn1
Show InChI InChI=1S/C15H20ClN7/c1-23-8-12(6-19-23)21-15-18-7-13(16)14(22-15)20-11-2-9-4-17-5-10(9)3-11/h6-11,17H,2-5H2,1H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 176n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK3


(Homo sapiens (Human))
BDBM239966
PNG
(US9403801, 31)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)S(C)(=O)=O)n2)cn1
Show InChI InChI=1S/C16H22ClN7O2S/c1-23-9-13(5-19-23)21-16-18-6-14(17)15(22-16)20-12-3-10-7-24(27(2,25)26)8-11(10)4-12/h5-6,9-12H,3-4,7-8H2,1-2H3,(H2,18,20,21,22)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 178n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx....


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK3


(Homo sapiens (Human))
BDBM239953
PNG
(US9403801, 12)
Show SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)cn1
Show InChI InChI=1S/C18H21ClN8O/c1-26-10-14(6-22-26)24-18-21-7-15(19)17(25-18)23-13-4-11-8-27(9-12(11)5-13)16(28)2-3-20/h6-7,10-13H,2,4-5,8-9H2,1H3,(H2,21,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 359n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx....


Citation and Details
More data for this
Ligand-Target Pair
Tyrosine-protein kinase JAK2


(Homo sapiens (Human))
BDBM239973
PNG
(US9403801, 41)
Show SMILES Cn1cnc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)c1
Show InChI InChI=1S/C18H21ClN8O/c1-26-9-15(22-10-26)24-18-21-6-14(19)17(25-18)23-13-4-11-7-27(8-12(11)5-13)16(28)2-3-20/h6,9-13H,2,4-5,7-8H2,1H3,(H2,21,23,24,25)
PDB

Reactome pathway
KEGG

UniProtKB/SwissProt

B.MOAD
DrugBank
GoogleScholar
AffyNet 
PC cid
PC sid
UniChem
US Patent
n/an/a 371n/an/an/an/an/an/a



CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD.

US Patent


Assay Description
JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...


Citation and Details
More data for this
Ligand-Target Pair
* indicates data uncertainty>20%