Affinity DataIC50: 25nMAssay Description:Inhibition of JAK2 (unknown origin)More data for this Ligand-Target Pair
3D Structure (crystal)Affinity DataIC50: 28nMAssay Description:Inhibition of recombinant JAK2 (unknown origin) in the presence of ATPMore data for this Ligand-Target Pair
Affinity DataIC50: 28nMAssay Description:Inhibition of JAK 2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 31.4nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 31.4nMAssay Description:Recombinant human JAK2 catalytic domain (amino acids 808-1132; catalog number PV4210) was purchased from Invitrogen. 0.025 mU of JAK2 was incubated w...More data for this Ligand-Target Pair
Affinity DataIC50: 41.2nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 55nMAssay Description:The study of the effect of compounds on the activity of purified recombinant JAK was performed by studying the inhibitory activity of the compounds o...More data for this Ligand-Target Pair
Affinity DataIC50: 55.5nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 73.4nMAssay Description:Recombinant human JAK2 catalytic domain (amino acids 808-1132; catalog number PV4210) is purchased from Invitrogen. 0.025 mU of JAK2 is incubated wit...More data for this Ligand-Target Pair
Affinity DataIC50: 74nMAssay Description:Inhibition of JAK2 (unknown origin) in presence of ATP at Km concentration by caliper assayMore data for this Ligand-Target Pair
Affinity DataIC50: 74nMAssay Description:JAK1 (KI): For the determination of Ki, different amounts of compound are mixed with the enzyme and the enzymatic reaction is followed as a function ...More data for this Ligand-Target Pair
Affinity DataIC50: <100nMAssay Description:Recombinant human JAK2 catalytic domain (amino acids 808-1132; catalog number PV4210) was purchased from Invitrogen. 0.025 mU of JAK2 was incubated w...More data for this Ligand-Target Pair
Affinity DataIC50: 122nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Affinity DataIC50: 167nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 171nMAssay Description:Inhibition of recombinant JAK2 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measure...More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2/Tyrosine-protein kinase JAK1/Tyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories
Curated by ChEMBL
Zhuhai United Laboratories
Curated by ChEMBL
Affinity DataIC50: 407nMAssay Description:Inhibition of JAK1/JAK2/TYK2 signalling in human whole blood assessed as inhibition of IL-6 stimulated STAT1 phosphorylation in CD4+ lymphocytes prei...More data for this Ligand-Target Pair
Affinity DataIC50: 460nMpH: 7.5Assay Description:A kinase selectivity panel which measures substrate peptide phosphorylation was set-up for recombinant human Jak1 (aa 866-1154), Jak2 (aa808-1132), J...More data for this Ligand-Target Pair
Affinity DataIC50: 460nMAssay Description:The assays were performed in 384-well, low volume microtiter assay plates in a final reaction volume of 9 ul. Dose-response curves were generated by ...More data for this Ligand-Target Pair
Affinity DataIC50: 460nMAssay Description:The assays were performed in 384-well, low volume microtiter assay plates in a final reaction volume of 9 ul. Dose-response curves were generated by ...More data for this Ligand-Target Pair
Affinity DataIC50: 2.40E+3nMAssay Description:Inhibition of recombinant human JAK2 assessed as phosphorylation level in presence of 1 mM ATPMore data for this Ligand-Target Pair
Affinity DataIC50: 3.52E+3nMAssay Description:Inhibition of JAK2 in IL3-induced human TF1 cells assessed as pSTAT5More data for this Ligand-Target Pair
Affinity DataIC50: 4.45E+3nMAssay Description:Inhibition of JAK2 (unknown origin) expressed in mouse BAF3 cells assessed as antiproliferative activity by cell-based assayMore data for this Ligand-Target Pair
Affinity DataIC50: 4.55E+3nMAssay Description:Inhibition of JAK2 in IL3-induced human BaF3 cells assessed as cell proliferationMore data for this Ligand-Target Pair
Affinity DataIC50: 5.33E+3nMAssay Description:Inhibition of JAK2 signalling in human whole blood assessed as inhibition of GM-CSF stimulated STAT5 phosphorylation in CD33+ monocytes preincubated ...More data for this Ligand-Target Pair
Affinity DataIC50: 6.77E+3nMAssay Description:Enzyme inhibition studies were performed using recombinant JAK1 (amino acids 866-1154, Life Technologies, #PV4774, Carlsbad, Calif.), JAK2 (amino aci...More data for this Ligand-Target Pair
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of JAK2 in EPO-induced human UT7-EPO cells assessed as pSTAT5More data for this Ligand-Target Pair
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of JAK2 in PRL-induced human 22Rv1 cells assessed as pSTAT5More data for this Ligand-Target Pair
Affinity DataIC50: 1.75E+4nMAssay Description:Inhibition of JAK2 in human whole blood assessed as inhibition of GM-CSF-induced pSTAT5More data for this Ligand-Target Pair
