BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:CAM-RNase A
Syringe Reactant:SecB
Meas. Tech.:ITC
Entry Date:12/13/00
 
ΔG°:-27.7± (kJ/mole)
pH:7.4±n/a
Log10Kb:4.90± n/a
Temperature:293.15±n/a (K)
ΔH° :-49.6± (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :-1.722±n/a (kJ/mole)
Stoich. Param.:1
ΔS° : -0.075± (kJ/mole-K)
Comments:discrepancies in the fluorescence and calorimetric-derived binding constants
 
Citation Panse, VGSwaminathan, CPSurolia, AVaradarajan, R Thermodynamics of substrate binding to the chaperone SecB. Biochemistry39:2420-7 (2000) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
CAM-RNase A
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:CAM-RNase A
Synonyms:RNAse A
Type:Enzyme
Mol. Mass.:16468.79
Organism:Bison bison (American bison)
Description:carboxamidomethylated RNase A
Residue:150
Sequence:
MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
SecB
Source:Expressed in E. coli strain BL21 (DE3)
Purity:99%
Prep. Method:Fast flow Q-Sepharose column, and then a Sephacryl S-200 gel filtration column
Name:SecB
Synonyms:n/a
Type:Protein
Mol. Mass.:17264.58
Organism:Escherichia coli
Description:D6JGS5
Residue:155
Sequence:
MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVL
RVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSR
GTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.