BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Thymidine Kinase
Syringe Reactant:BDBM3
Meas. Tech.:ITC
Entry Date:12/13/00
 
ΔG°:-17.3±0.350 (kcal/mole)
pH:7.5±n/a
Log10Kb:n/a
Temperature:293.15±n/a (K)
ΔH° :-30.6±1.53 (kcal/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:yes
Protons Released:-0.35
ΔCp :-0.51±0.02 (kcal/mole)
Stoich. Param.:n/a
ΔS° :-0.0500±0.0100 (kcal/mole-K)
Comments:n/a
 
Citation Perozzo, RJelesarov, IBosshard, HRFolkers, GScapozza, L Compulsory order of substrate binding to herpes simplex virus type 1 thymidine kinase. A calorimetric study. J Biol Chem275:16139-45 (2000) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Thymidine Kinase
Source:Expressed as glutathione S-transferase fusion protein in E. coli.
Purity:n/a
Prep. Method:Purified by glutathione affinity chromatography.
Name:Thymidine kinase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:40978.57
Organism:Human herpesvirus 1
Description:P03176
Residue:376
Sequence:
MASYPCHQHASAFDQAARSRGHNNRRTALRPRRQQEATEVRPEQKMPTLLRVYIDGPHGM
GKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVV
MTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDRHPIAALLCYPAARYLMG
SMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVYG
LLANTVRYLQCGGSWREDWGQLSGTAVPPQGAEPQSNAGPRPHIGDTLFTLFRAPELLAP
NGDLYNVFAWALDVLAKRLRSMHVFILDYDQSPAGCRDALLQLTSGMVQTHVTTPGSIPT
ICDLARTFAREMGEAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3
Source:Sigma
Purity:n/a
Prep. Method:n/a
NameBDBM3
Synonyms:thymidine/ATP (1:1 mixture)
Typen/a
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure 

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.