BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HyHEL-5 Fab
Syringe Reactant:Lysozyme (hen egg)
Meas. Tech.:ITC and sedimentation equilibrium
Entry Date:12/13/00
 
ΔG°:-60.9± (kJ/mole)
pH:8±n/a
Log10Kb:10.6± n/a
Temperature:298.15±n/a (K)
ΔH° :-95.8±0.840 (kJ/mole)
ΔHobs :-95.8± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :-1.722±0.076 (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.117± (kJ/mole-K)
Comments:data from Lavoie, T. B., Drohan, W. N., and Smith-Gill, S. J. (1992) J. Immunol. 148, 503-513
 
Citation Wibbenmeyer, JASchuck, PSmith-Gill, SJWillson, RC Salt links dominate affinity of antibody HyHEL-5 for lysozyme through enthalpic contributions. J Biol Chem274:26838-42 (1999) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
HyHEL-5 Fab
Source:Recombinant HyHEL-5 Fab was expressed in E. coli.
Purity:95%
Prep. Method:Refolded protein was purified by Q Sepharose and nickel-charged chelating Sepharose Fast Flow Chromatography
Name:HyHEL-5 Fab
Synonyms:n/a
Type:Antibody
Mol. Mass.:23011.84
Organism:Mus musculus (mouse)
Description:Monoclonal antibody to hen egg lysozyme
Residue:215
Sequence:
EVQLQQSGAELMKPGASVKISCKASGYTFSDYWIEWVKQRPGHGLEWIGEILPGSGSTNY
HERFKGKATFTADTSSSTAYMQLNSLTSEDSGVYYCLHGNYDFDGWGQGTTLTVSSAKTT
PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKILD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Lysozyme (hen egg)
Source:Worthington Biologicals
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (hen egg)
Synonyms:FvD1.3(VLW92A) | FvD1.3(VLW92D) | FvD1.3(VLW92F) | FvD1.3(VLW92H) | FvD1.3(VLW92S) | FvD1.3(VLW92V) | FvD1.3(VLW92wt) | hen egg lysozyme (HEL)
Type:Enzyme
Mol. Mass.:16248.07
Organism:Gallus gallus (chicken)
Description:P00698
Residue:147
Sequence:
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG
NGMNAWVAWRNRCKGTDVQAWIRGCRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.