BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HyHEL-5 Mutant(E50Q)
Syringe Reactant:Lysozyme (hen egg)
Meas. Tech.:ITC and sedimentation equilibrium
Entry Date:12/13/00
 
ΔG°:-34.0±1.26 (kJ/mole)
pH:8±n/a
Log10Kb:5.97± n/a
Temperature:298.15±n/a (K)
ΔH° :-68.9±1.68 (kJ/mole)
ΔHobs :-68.9± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :-1.617±0.046 (kJ/mole)
Stoich. Param.:1
ΔS° : -0.117±0.00300 (kJ/mole-K)
Comments:n/a
 
Citation Wibbenmeyer, JASchuck, PSmith-Gill, SJWillson, RC Salt links dominate affinity of antibody HyHEL-5 for lysozyme through enthalpic contributions. J Biol Chem274:26838-42 (1999) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
HyHEL-5 Mutant(E50Q)
Source:Site-directed mutagenesis of recombinant HyHEL-5 Fab
Purity:95%
Prep. Method:Refolded protein was purified by Q Sepharose and nickel-charged chelating Sepharose Fast Flow Chromatography
Name:HyHEL-5 Mutant(E50Q)
Synonyms:HyHEL-5 Fab mutant (E50Q)
Type:Antibody
Mol. Mass.:23011.87
Organism:Mus musculus (mouse)
Description:mutant of murine monoclonal antibody HyHEL-5 to hen egg lysozyme
Residue:215
Sequence:
EVQLQQSGAELMKPGASVKISCKASGYTFSDYWIEWVKQRPGHGLEWIGQILPGSGSTNY
HERFKGKATFTADTSSSTAYMQLNSLTSEDSGVYYCLHGNYDFDGWGQGTTLTVSSAKTT
PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKILD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Lysozyme (hen egg)
Source:Worthington Biologicals
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (hen egg)
Synonyms:FvD1.3(VLW92A) | FvD1.3(VLW92D) | FvD1.3(VLW92F) | FvD1.3(VLW92H) | FvD1.3(VLW92S) | FvD1.3(VLW92V) | FvD1.3(VLW92wt) | hen egg lysozyme (HEL)
Type:Enzyme
Mol. Mass.:16248.07
Organism:Gallus gallus (chicken)
Description:P00698
Residue:147
Sequence:
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG
NGMNAWVAWRNRCKGTDVQAWIRGCRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.