BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HyHEL-5 Fab
Syringe Reactant:Lysozyme (bobwhite quail)
Meas. Tech.:ITC and sedimentation equilibrium
Entry Date:12/13/00
 
ΔG°:-39.1±0.420 (kJ/mole)
pH:8±n/a
Log10Kb:6.82± n/a
Temperature:298.15±n/a (K)
ΔH° :-76.9±3.36 (kJ/mole)
ΔHobs :-76.9± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :-1.084±0.034 (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.127±0.0100 (kJ/mole-K)
Comments:data from Wibbenmeyer, J. A., Xavier, K. A., Smith-Gill, S. J., and Willson, R. C. (1999) Biochim. Biophys. Acta 1430, 191-202
 
Citation Wibbenmeyer, JASchuck, PSmith-Gill, SJWillson, RC Salt links dominate affinity of antibody HyHEL-5 for lysozyme through enthalpic contributions. J Biol Chem274:26838-42 (1999) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
HyHEL-5 Fab
Source:Recombinant HyHEL-5 Fab was expressed in E. coli.
Purity:95%
Prep. Method:Refolded protein was purified by Q Sepharose and nickel-charged chelating Sepharose Fast Flow Chromatography
Name:HyHEL-5 Fab
Synonyms:n/a
Type:Antibody
Mol. Mass.:23011.84
Organism:Mus musculus (mouse)
Description:Monoclonal antibody to hen egg lysozyme
Residue:215
Sequence:
EVQLQQSGAELMKPGASVKISCKASGYTFSDYWIEWVKQRPGHGLEWIGEILPGSGSTNY
HERFKGKATFTADTSSSTAYMQLNSLTSEDSGVYYCLHGNYDFDGWGQGTTLTVSSAKTT
PPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSTWPSETVTCNVAHPASSTKVDKKILD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Lysozyme (bobwhite quail)
Source:Prepared from eggs purchased from Stevenson's Game Bird Farm (Riverside, TX)
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (bobwhite quail)
Synonyms:bobwhite quail lysozyme(BQL)
Type:Enzyme
Mol. Mass.:14279.53
Organism:Colinus virginianus
Description:hydrolase
Residue:129
Sequence:
KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNTDGSTDYGVLQINS
RWWCNDGKTPGSRNLCNIPCSALLSSDITATVNCAKKIVSDGNGMNAWVAWRNRCKGTDV
QAWIRGCRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.