BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:D44.1 Fab
Syringe Reactant:Lysozyme (hen egg)
Meas. Tech.:ITC
Entry Date:12/11/00
 
ΔG°:-40.2±0.300 (kJ/mole)
pH:7.1±n/a
Log10Kb:7.38± 6.48
Temperature:284.85±0.1 (K)
ΔH° :-31.3± (kJ/mole)
ΔHobs :-31.3± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :-1.16±0.006 (kJ/mole)
Stoich. Param.:n/a
ΔS° : 0.031±0.00600 (kJ/mole-K)
Comments:n/a
 
Citation Schwarz, FPTello, DGoldbaum, FAMariuzza, RAPoljak, RJ Thermodynamics of antigen-antibody binding using specific anti-lysozyme antibodies. Eur J Biochem228:388-94 (1995) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
D44.1 Fab
Source:n/a
Purity:n/a
Prep. Method:Papain-cleaved antigen binding fragment of D44.1
Name:D44.1 Fab
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:D44.1 Fab chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:23585.62
Organism:Mus musculus (mouse)
Description:Immunoglobulin
Residue:214
Sequence:
DIELTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYVSQSSSGIPS
RFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPRTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:D44.1 Fab chain B
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:23199.17
Organism:Mus musculus (mouse)
Description:Immunoglobulin
Residue:218
Sequence:
QVQLQESGAEVMKPGASVKISCKATGYTFSTYWIEWVKQRPGHGLEWIGEILPGSGSTYY
NEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGDGNYGYWGQGTTLTVSSASTT
PPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Lysozyme (hen egg)
Source:Sigma Chemical Co.
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (hen egg)
Synonyms:D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:Enzyme
Mol. Mass.:16805.63
Organism:Mus musculus (mouse)
Description:P17897
Residue:148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRA
TNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRTQCQNRDLSQYIRNCGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.