BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:F9.13.7 mAb
Syringe Reactant:Lysozyme (hen egg)
Meas. Tech.:ITC
Entry Date:12/11/00
 
ΔG°:-48.2±0.800 (kJ/mole)
pH:7.1±n/a
Log10Kb:8.11± 7.60
Temperature:309.95±0.1 (K)
ΔH° :-70.9± (kJ/mole)
ΔHobs :-70.9± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :-2.72±0.16 (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.073±0.0190 (kJ/mole-K)
Comments:n/a
 
Citation Schwarz, FPTello, DGoldbaum, FAMariuzza, RAPoljak, RJ Thermodynamics of antigen-antibody binding using specific anti-lysozyme antibodies. Eur J Biochem228:388-94 (1995) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
F9.13.7 mAb
Source:Balb/c mice
Purity:n/a
Prep. Method:Obtained by cell fusion after 5 injections of antigen over a period of 6 months
Name:F9.13.7 mAb
Synonyms:n/a
Type:Antibody
Mol. Mass.:358.43
Organism:Mus musculus (mouse)
Description:Monoclonal IgG antibody to hen egg lysozyme
Residue:3
Sequence:
n/a
 
Lysozyme (hen egg)
Source:Sigma Chemical Co.
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (hen egg)
Synonyms:D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:Enzyme
Mol. Mass.:16805.63
Organism:Mus musculus (mouse)
Description:P17897
Residue:148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRA
TNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRTQCQNRDLSQYIRNCGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.