BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:D1.3 Fv
Syringe Reactant:Lysozyme (hen egg)
Meas. Tech.:ITC
Entry Date:12/11/00
 
ΔG°:-42.6±1 (kJ/mole)
pH:7.1±n/a
Log10Kb:6.89± 6.46
Temperature:322.95±0.1 (K)
ΔH° :-129± (kJ/mole)
ΔHobs :-129± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :-1.58±0.06 (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.268±0.0220 (kJ/mole-K)
Comments:n/a
 
Citation Schwarz, FPTello, DGoldbaum, FAMariuzza, RAPoljak, RJ Thermodynamics of antigen-antibody binding using specific anti-lysozyme antibodies. Eur J Biochem228:388-94 (1995) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
D1.3 Fv
Source:Recombinant protein expressed from E. coli
Purity:n/a
Prep. Method:Cell lysate was purified by affinity chromatography
Name:D1.3 Fv
Synonyms:n/a
Type:Antibody
Mol. Mass.:24477.57
Organism:Mus musculus (mouse)
Description:Fv fragment of mouse monoclonal antobody D1.3
Residue:222
Sequence:
DIVLTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTLADGVPSRF
SGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLEIKRQVQLQESGPGLVAP
SQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNS
KSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Lysozyme (hen egg)
Source:Sigma Chemical Co.
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (hen egg)
Synonyms:D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:Enzyme
Mol. Mass.:16805.63
Organism:Mus musculus (mouse)
Description:P17897
Residue:148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRA
TNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRTQCQNRDLSQYIRNCGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.