BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Acetate Operon Repressor (C-IclR)
Syringe Reactant:BDBM19472
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:12/10/07
 
ΔG°:-33.9± (kJ/mole)
pH:7.4±n/a
Log10Kb:6.08± 5.30
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-42.2± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:0.5
ΔS° : -0.0275± (kJ/mole-K)
Comments:n/a
 
Citation Lorca, GLEzersky, ALunin, VVWalker, JRAltamentova, SEvdokimova, EVedadi, MBochkarev, ASavchenko, A Glyoxylate and pyruvate are antagonistic effectors of the Escherichia coli IclR transcriptional regulator. J Biol Chem282:16476-91 (2007) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Acetate Operon Repressor (C-IclR)
Source:His-tagged fusion protein was overexpressed and purified in E. coli.
Purity:n/a
Prep. Method:The His6 tag was cleaved from the protein by tobacco etch virus protease. The cleaved protein was then resolved by flowing the mixture through a second Ni2+ column. The purified proteins were dialyzed and concentrated.
Name:Acetate Operon Repressor (IclR)
Synonyms:n/a
Type:Transcriptional regulator
Mol. Mass.:29746.52
Organism:Escherichia coli
Description:n/a
Residue:274
Sequence:
MVAPIPAKRGRKPAVATAPATGQVQSLTRGLKLLEWIAESNGSVALTELAQQAGLPNSTT
HRLLTTMQQQGFVRQVGELGHWAIGAHAFMVGSSFLQSRNLLAIVHPILRNLMEESGETV
NMAVLDQSDHEAIIIDQVQCTHLMRMSAPIGGKLPMHASGAGKAFLAQLSEEQVTKLLHR
KGLHAYTHATLVSPVHLKEDLAQTRKRGYSFDDEEHALGLRCLAACIFDEHREPFAAISI
SGPISRITDDRVTEFGAMVIKAAKEVTLAYGGMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19472
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM19472
Synonyms:2-oxoacetic acid | Glyoxylate | Oxoethanoic acid | glyoxylic acid | oxaldehydic acid
TypeSmall organic molecule
Emp. Form.C2H2O3
Mol. Mass.74.0355
SMILESOC(=O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.