BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Cytochrome P450 2B4 Mutant (F206A)
Syringe Reactant:BDBM19474
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:12/10/07
 
Δ G ° :n/a
pH:7.4±n/a
Log10Kb:5.59± n/a
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-45.6± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.0463± (kJ/mole-K)
Comments:n/a
 
Citation Wang, BZWang, JWu, Q [BRCA1 protein expression in sporadic breast and its clinical significance]. Zhonghua Wai Ke Za Zhi41:186-8 (2003) [PubMed]
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Cytochrome P450 2B4 Mutant (F206A)
Source:Purified from E. coli.
Purity:n/a
Prep. Method:Cold ethanol was added to the protein to a final concentration of 2% just prior to the temperature equilibration, and the sample was loaded into the calorimetric cell.
Name:Cytochrome P450 2B4 Mutant (F206A)
Synonyms:2B4dH(H226Y) mutant F206A | CYPIIB4 | N-terminal truncated and modified form of P450 2B4 | P450 types B0 and B1 | P450-LM2
Type:Enzyme
Mol. Mass.:54034.11
Organism:Oryctolagus cuniculus (rabbit)
Description:F206A was created using 2B4dH(H226Y) as a template. 2B4dH(H226Y) is an N-terminal truncated and modified and C-terminal His-tagged form of P450 2B4 engineered for enhanced solubility and containing a His- 226 to Tyr substitution to prevent dimerization.
Residue:476
Sequence:
MAKKTSSKGKLPPGPSPLPVLGNLLQMDRKGLLRSFLRLREKYGDVFTVYLGSRPVVVLC
GTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGERWRALRRFSLATMRDFGMGK
RSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIICSIVFGKRFDYKDPVFLRLL
DLFFQSASLISSFSSQVFELFSGFLKYFPGTHRQIYRNLQEINTFIGQSVEKHRATLDPS
NPRDFIDVYLLRMEKDKSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPH
VTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRG
YVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALKRNEGFMPFSLGKRICLGE
GIARTELFLFFTTILQNFSIASPVPPEDIDLTPRESGVGNVPPSYQIRFLARHHHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19474
Source:Sigma-Aldrich
Purity:n/a
Prep. Method:n/a
NameBDBM19474
Synonyms:1-(4-chlorophenyl)-1H-imidazole | 1-(4-chlorophenyl)imidazole | 1-CPI
TypeSmall organic molecule
Emp. Form.C9H7ClN2
Mol. Mass.178.618
SMILESClc1ccc(cc1)-n1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.