BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Estrogen-Related Receptor, alpha Mutant (C325S)
Syringe Reactant:BDBM22421
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:05/29/08
 
Δ G ° :n/a
pH:7.5±n/a
Log10Kb:6.03± n/a
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-54.3± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.0659± (kJ/mole-K)
Comments:n/a
 
Citation Kallen, JLattmann, RBeerli, RBlechschmidt, ABlommers, MJGeiser, MOttl, JSchlaeppi, JMStrauss, AFournier, B Crystal structure of human estrogen-related receptor alpha in complex with a synthetic inverse agonist reveals its novel molecular mechanism. J Biol Chem282:23231-9 (2007) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Estrogen-Related Receptor, alpha Mutant (C325S)
Source:Recombinant ERR alpha mutant ligand-binding domain was cloned and expressed in sf9 insect cells.
Purity:The purification of the frozen Sf9 cell pellets was done by three-step chromatography. SDS-PAGE analysis revealed good and soluble expression of ERR apha LBD.
Prep. Method:n/a
Name:Estrogen-Related Receptor, alpha Mutant (C325S)
Synonyms:ERR-alpha | Nuclear receptor subfamily 3 group B member 1 | Steroid hormone receptor ERR1
Type:Ligand Binding Domain
Mol. Mass.:25035.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:230
Sequence:
VNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLSDLFDREIVVTISWAKSIPGFSSLS
LSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLV
RRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLEYEAGRAGPGGGA
ERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAMMD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22421
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM22421
Synonyms:(cyclohexylmethyl)[(1-phenyl-1H-indol-3-yl)methyl]amine | Indole compound 1b
TypeSmall organic molecule
Emp. Form.C22H26N2
Mol. Mass.318.4552
SMILESC(NCc1cn(-c2ccccc2)c2ccccc12)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.