BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:v-Src SH2 Domain
Syringe Reactant:BDBM22596
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/14/08
 
ΔG°:-39.9± (kJ/mole)
pH:6±n/a
Log10Kb:7± 6.00
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-34.8±0.150 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.0171± (kJ/mole-K)
Comments:n/a
 
Citation Taylor, JDGilbert, PJWilliams, MAPitt, WRLadbury, JE Identification of novel fragment compounds targeted against the pY pocket of v-Src SH2 by computational and NMR screening and thermodynamic evaluation. Proteins67:981-90 (2007) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
v-Src SH2 Domain
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Tyrosine-protein kinase transforming protein Src
Synonyms:p60-Src | v-Src | v-Src SH2 Domain
Type:SH2 Domain
Mol. Mass.:58884.32
Organism:Avian leukosis virus (RSA)
Description:P00524
Residue:526
Sequence:
MGSSKSKPKDPSQRRCSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHR
LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPG
TMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRL
PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMGNGEVLDRVERGYR
MPCPPECPESLHDLMCQCWRRDPEERPTFEYLQAQLLPACVLEVAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22596
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM22596
Synonyms:(4S)-4-{[(1S)-1-{[(2S)-1-[(2S)-2-{[(1S)-1-carbamoyl-2-methylbutyl]carbamoyl}pyrrolidin-1-yl]-3-methyl-1-oxopentan-2-yl]carbamoyl}-3-carboxypropyl]carbamoyl}-4-[(2S)-2-[(2S)-2-{[(2S)-1-acetylpyrrolidin-2-yl]formamido}pentanediamido]-3-[4-(phosphonooxy)phenyl]propanamido]butanoic acid | Ac-PQpYEEIPI-NH2
TypePhosphotyrosyl peptide
Emp. Form.C48H73N10O18P
Mol. Mass.1109.1232
SMILESCCC(C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](Cc1ccc(OP(O)(O)=O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(C)=O)C(C)CC)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.