BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:v-Src SH2 Domain
Syringe Reactant:BDBM22597
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/14/08
 
ΔG°:-21.4± (kJ/mole)
pH:6±n/a
Log10Kb:3.76± 2.95
Temperature:298.15±n/a (K)
ΔH° :n/a
ΔHobs :-3.30±0.490 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.0607± (kJ/mole-K)
Comments:ITC data were obtained through competition experiments using high affinity peptide (PQpYEEIPI) as the competitor.
 
Citation Taylor, JDGilbert, PJWilliams, MAPitt, WRLadbury, JE Identification of novel fragment compounds targeted against the pY pocket of v-Src SH2 by computational and NMR screening and thermodynamic evaluation. Proteins67:981-90 (2007) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
v-Src SH2 Domain
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Tyrosine-protein kinase transforming protein Src
Synonyms:p60-Src | v-Src | v-Src SH2 Domain
Type:SH2 Domain
Mol. Mass.:58884.32
Organism:Avian leukosis virus (RSA)
Description:P00524
Residue:526
Sequence:
MGSSKSKPKDPSQRRCSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHR
LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPG
TMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRL
PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMGNGEVLDRVERGYR
MPCPPECPESLHDLMCQCWRRDPEERPTFEYLQAQLLPACVLEVAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22597
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM22597
Synonyms:(2S)-2-amino-3-[4-(phosphonooxy)phenyl]propanoic acid | Phosphonotyrosine | Phosphotyrosine (pY)
Type Phosphoamino Acid
Emp. Form.C9H12NO6P
Mol. Mass.261.1684
SMILESN[C@@H](Cc1ccc(OP(O)(O)=O)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.