BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Rho Transcription Termination Factor
Syringe Reactant:BDBM22601
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/14/08
 
ΔG°:-29.8±0.0836 (kJ/mole)
pH:7.9±n/a
Log10Kb:5.20± 3.70
Temperature:299.15±n/a (K)
ΔH° :n/a
ΔHobs :-5.60±2.59 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:6
ΔS° : 0.0808±0.00360 (kJ/mole-K)
Comments:The stoichiometry parameter was fixed to six, or for the two site model, two integers with a sum of six.
 
Citation Brogan, APWidger, WRBensadek, DRiba-Garcia, IGaskell, SJKohn, H Development of a technique to determine bicyclomycin-rho binding and stoichiometry by isothermal titration calorimetry and mass spectrometry. J Am Chem Soc127:2741-51 (2005) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Rho Transcription Termination Factor
Source:The open reading frame encoding the full-length Escherichia coli Rho protein was PCR amplified and cloned. The protein was overexpressed in E. coli strain BL21 (pLysS).
Purity:99%
Prep. Method:The protein was twice purified over a POROS-HS column (Perseptive Biosystems) then further purified with two successive Sephacryl S-300 (Amersham) sizing columns. The protein at this stage was more than 99% pure as judged by SDS-PAGE.
Name:Rho Transcription Termination Factor
Synonyms:ATP-dependent helicase rho
Type:Enzyme
Mol. Mass.:47006.70
Organism:Escherichia coli (strain K12)
Description:Rho is a hexameric RNA/DNA helicase/translocase.
Residue:419
Sequence:
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD
GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN
FDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP
KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV
QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF
FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY
NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22601
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM22601
Synonyms:3-({[(1S,6R)-6-hydroxy-8,10-dioxo-1-[(1S,2S)-1,2,3-trihydroxy-2-methylpropyl]-2-oxa-7,9-diazabicyclo[4.2.2]decan-5-yl]methyl}sulfanyl)benzaldehyde | 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin | FPD | FPDB
TypeAntibiotic
Emp. Form.C19H24N2O8S
Mol. Mass.440.467
SMILESC[C@](O)(CO)[C@H](O)[C@@]12NC(=O)[C@@](O)(NC1=O)C(CSc1cccc(C=O)c1)CCO2 |TLB:10:9:13.14:29.16.28.27,THB:15:14:8.9:29.16.28.27,17:16:13.14:8.9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.