BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:PLD beta C2
Syringe Reactant:BDBM14
Meas. Tech.:ITC and CD
Entry Date:12/04/00
 
ΔG°:-35.7± (kJ/mole)
pH:7.5±n/a
Log10Kb:6.10± n/a
Temperature:303.15±n/a (K)
ΔH° :0.588± (kJ/mole)
ΔHobs :0.588± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.1192± (kJ/mole-K)
Comments:PLD beta has two classes of binding sites
 
Citation Zheng, LKrishnamoorthi, RZolkiewski, MWang, X Distinct Ca2+ binding properties of novel C2 domains of plant phospholipase dalpha and beta. J Biol Chem275:19700-6 (2000) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
PLD beta C2
Source:poly-His-fused C2 proteins were expressed in E. coli BL21(DE3)
Purity:n/a
Prep. Method:C2 proteins without the tag were refolded by passing through a Sephacryl S-100 gel filtration column.Proteins were dissolved in Chelex-100 treated buffer
Name:PLD beta C2
Synonyms:PLD beta C2 domain
Type:Protein
Mol. Mass.:121118.74
Organism:Arabidopsis thaliana
Description:P93733
Residue:1083
Sequence:
MDNHGPRYPYPYGQYPYPYPYPAPYRPPSSEPYPPPPTNQYSAPYYPYPPPPYATPPPYA
SPPPPHQHTSGSHSGPLDYSHNPQPSSLAAAPPEYHRHSFDYQPSPYPYQPQGNFGAYGP
PPPHYSYQEPAQYPPPETKPQEPLPPPQQTQGFQEYRRQDCLSTGGTGHDNVSNSGSSYP
PVDELLGGLHISTNQPGPSVPQLSSLPSNSWQSRPGDLYGYPNSSFPSNSHLPQLGRVDS
SSSYYASTESPHSADMQMTLFGKGSLKVLLLHGNLDIWIYHAKNLPNMDMFHKTLGDMFG
RLPGKIEGQLTSKITSDPYVSVSVAGAVIGRTYVMSNSENPVWMQHFYVPVAHHAAEVHF
VVKDSDVVGSQLIGLVTIPVEQIYSGAKIEGTYPILNSNGKPCKPGANLSLSIQYTPMDK
LSVYHHGVGAGPDYQGVPGTYFPLRKGGTVRLYQDAHVPEGMLPGIRLDNGMSYEHGKCW
HDMFDAIRQARRLIYITGWSVWHKVKLIRDKLGPASECTLGELLRSKSQEGVRVLLLIWD
DPTSRSILGYKTDGVMATHDEETRRFFKHSSVQVLLCPRNAGKRHSWVKQREVGTIYTHH
QKNVIVDADAGGNRRKIIAFVGGLDLCDGRYDTPQHPLFRTLQTIHKDDFHNPTFTGNLS
GCPREPWHDLHSKIDGPAAYDVLTNFEERWLKAAKPSGIKKFKTSYDDALLRIDRIPDIL
GVSDTPTVSENDPEAWHVQIFRSIDSNSVKGFPKDPKDATCKNLVCGKNVLIDMSIHTAY
VKAIRAAQHFIYIENQYFIGSSYNWNAHKDIGANNLIPMEIALKIAEKIRANERFAAYIV
IPMWPEGVPTGAATQRILYWQHKTIQMMYETIYKALVETGLEGAFSPQDYLNFFCLGNRE
MVDGIDNSGTGSPSNANTPQALSRKSRRFMVYVHSKGMVVDDEYVVIGSANINQRSMEGT
RDTEIAMGAYQPQHTWARKHSGPRGQIYGYRMSLWAEHMATLDDCFTQPESIECVRKVRT
MGERNWKQFAAEEVSDMRGHLLKYPVEVDRKGKVRPLPGSETFPDVGGNIVGSFIAIQEN
LTI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14
Source:Fisher Scientific
Purity:n/a
Prep. Method:n/a
NameBDBM14
Synonyms:Ca2+ | calcium
TypeMetal Ion
Emp. Form.Ca
Mol. Mass.40.077
SMILES[Ca++]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.