BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Lysozyme (hen egg)
Syringe Reactant:Lysozyme (hen egg)
Meas. Tech.:ITC
Entry Date:12/11/00
 
ΔG°:-49±0.800 (kJ/mole)
pH:7.1±n/a
Log10Kb:9.00± 8.60
Temperature:284.45±0.1 (K)
ΔH° :-67.8± (kJ/mole)
ΔHobs :-67.8± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :-1.58±0.06 (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.067±0.00700 (kJ/mole-K)
Comments:n/a
 
Citation Bhat, TNBentley, GABoulot, GGreene, MITello, DDall'Acqua, WSouchon, HSchwarz, FPMariuzza, RAPoljak, RJ Bound water molecules and conformational stabilization help mediate an antigen-antibody association. Proc Natl Acad Sci U S A91:1089-93 (1994) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Lysozyme (hen egg)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (hen egg)
Synonyms:D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:Enzyme
Mol. Mass.:16805.63
Organism:Mus musculus (mouse)
Description:P17897
Residue:148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRA
TNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRTQCQNRDLSQYIRNCGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Lysozyme (hen egg)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (hen egg)
Synonyms:D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:Enzyme
Mol. Mass.:16805.63
Organism:Mus musculus (mouse)
Description:P17897
Residue:148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRA
TNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRD
PQGIRAWVAWRTQCQNRDLSQYIRNCGV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.