BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Transcriptional Regulator TtgR-DNA
Syringe Reactant:BDBM23447
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:07/23/08
 
ΔG°:-26.7±0.0836 (kJ/mole)
pH:7±n/a
Log10Kb:4.60± 3.00
Temperature:303.15±n/a (K)
ΔH° :n/a
ΔHobs :-47.2±0.669 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.0678±0.00220 (kJ/mole-K)
Comments:n/a
 
Citation Terán, WKrell, TRamos, JLGallegos, MT Effector-repressor interactions, binding of a single effector molecule to the operator-bound TtgR homodimer mediates derepression. J Biol Chem281:7102-9 (2006) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Transcriptional Regulator TtgR-DNA
Source:TtgR protein was over-expressed and purified from E. coli. DNA fragment was obtained by annealing two complementary oligonucleotides.
Purity:n/a
Prep. Method:Purified TtgR was placed into the ITC cell and titrated by the addition of the 40-bp DNA fragment. The completeness of protein saturation with DNA was verified by polyacrylamide gel electrophoresis.
Name:Transcriptional Regulator TtgR-DNA
Synonyms:n/a
Type:DNA Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Transcriptional Regulator TtgR
Synonyms:HTH-type transcriptional regulator ttgR | Toluene efflux pump ttgABC operon repressor
Type:Repressor; homodimer
Mol. Mass.:23852.57
Organism:Pseudomonas putida
Description:n/a
Residue:210
Sequence:
MVRRTKEEAQETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQ
ALLDSLHETHDHLARASESEDEVDPLGCMRKLLLQVFNELVLDARTRRINEILHHKCEFT
DDMCEIRQQRQSAVLDCHKGITLALANAVRRGQLPGELDAERAAVAMFAYVDGLIRRWLL
LPDSVDLLGDVEKWVDTGLDMLRLSPALRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:TtgR Operator-Containing DNA Fragment
Synonyms:n/a
Type:Duplex DNA
Mol. Mass.:3377.80
Organism:n/a
Description:n/a
Residue:40
Sequence:
5-CAGCAGTATTTACAAACAACCATGAATGTAAGTATATTCC-3
 
BDBM23447
Source:n/a
Purity:n/a
Prep. Method:All chemicals were manipulated in glass vessels and effector samples were neither degassed nor filtered, to avoid evaporation or nonspecific binding.
NameBDBM23447
Synonyms:2,2-dichloro-N-[(1R,2R)-1,3-dihydroxy-1-(4-nitrophenyl)propan-2-yl]acetamide | Chloramphenicol | Chlornitromycin | Chloromycetin
TypeSmall organic molecule
Emp. Form.C11H12Cl2N2O5
Mol. Mass.323.129
SMILESOC[C@@H](NC(=O)C(Cl)Cl)[C@H](O)c1ccc(cc1)[N+]([O-])=O
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.