BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HyHEL-10 Mutant (HY58F)
Syringe Reactant:Lysozyme (turkey egg)
Meas. Tech.:ITC
Entry Date:12/20/00
 
ΔG°:-49.6± (kJ/mole)
pH:7.2±n/a
Log10Kb:8.41± n/a
Temperature:308±n/a (K)
ΔH° :-111± (kJ/mole)
ΔHobs :-111± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :-2.68±n/a (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.2± (kJ/mole-K)
Comments:n/a
 
Citation Nishimiya, YTsumoto, KShiroishi, MYutani, KKumagai, I Thermodynamic consequences of grafting enhanced affinity toward the mutated antigen onto an antibody. The case of anti-lysozyme antibody, HyHEL-10. J Biol Chem275:12813-20 (2000) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
HyHEL-10 Mutant (HY58F)
Source:Described in Rajpal, A., Taylor, M. G., and Kirsch, J. F. (1998) Protein Sci. 7, 1868-1874.
Purity:n/a
Prep. Method:n/a
Name:HyHEL-10 Mutant (HY58F)
Synonyms:n/a
Type:Antibody
Mol. Mass.:12768.84
Organism:Mus musculus (mouse)
Description:Mutation in heavy chain of HyHEL-10
Residue:114
Sequence:
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTFYN
PSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Lysozyme (turkey egg)
Source:Sigma
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (turkey egg)
Synonyms:turkey egg lysozyme (TEL)
Type:Enzyme
Mol. Mass.:16145.52
Organism:Meleagris gallopavo
Description:P00703
Residue:147
Sequence:
MRSLLILVLCFLPLAALGKVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSKNLCNIPCSALLSSDITASVNCAKKIASGG
NGMNAWVAWRNRCKGTDVHAWIRGCRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.