BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:sc1E3
Syringe Reactant:hIL-1beta
Meas. Tech.:ITC
Entry Date:12/05/00
 
ΔG°:-46.2±0.420 (kJ/mole)
pH:7±n/a
Log10Kb:8.06± 7.07
Temperature:298.15±n/a (K)
ΔH° :-63.8±0.420 (kJ/mole)
ΔHobs :-63± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:yes
Protons Released:0.15
ΔCp :-1.19±0.349 (kJ/mole)
Stoich. Param.:n/a
ΔS° : -0.06±0.00100 (kJ/mole-K)
Comments:n/a
 
Citation Chrunyk, BARosner, MHCong, YMcColl, ASOtterness, IGDaumy, GO Inhibiting protein-protein interactions: a model for antagonist design Biochemistry39:7092-7099 (2000)  
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
sc1E3
Source:Protein was expressed in E.coli consisted of the C-terminal end of the VL of the mAb1E3 joined to the N-terminal end of the VH by a linker.
Purity:n/a
Prep. Method:Cell suspension was purified by bound to anti-Flag M2 affinity column, and then a HiLoad Superdex 75 16/60 column
Name:sc1E3
Synonyms:n/a
Type:Single Chain Antibody
Mol. Mass.:358.43
Organism:Escherichia coli
Description:single chain antibody that blocked binding between IL-1beta and IL-1 receptor
Residue:3
Sequence:
n/a
 
hIL-1beta
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:hIL-1beta
Synonyms:Interleukin 1-beta | Interleukin-1 beta
Type:Cytokine
Mol. Mass.:30734.47
Organism:Homo sapiens (Human)
Description:P01584
Residue:269
Sequence:
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.