BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
Syringe Reactant:Bak
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:09/13/09
 
Δ G ° :n/a
pH:7.4±n/a
Log10Kb:8.59± n/a
Temperature:298.15±n/a (K)
ΔH° :-92.4± (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:yes
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.1455± (kJ/mole-K)
Comments:n/a
 
Citation Day, CLSmits, CFan, FCLee, EFFairlie, WDHinds, MG Structure of the BH3 domains from the p53-inducible BH3-only proteins Noxa and Puma in complex with Mcl-1. J Mol Biol380:958-71 (2008) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
Source:The protein was expressed in E. coli as a GST-fusion.
Purity:n/a
Prep. Method:n/a
Name:Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
Synonyms:Bcl-2-related protein EAT/mcl1 | Mcl-1
Type:Developmental protein
Mol. Mass.:35215.08
Organism:Mus musculus (Mouse)
Description:n/a
Residue:331
Sequence:
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP
PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA
VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF
HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Bak
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Bak
Synonyms:Bcl-2 homologous antagonist/killer (aa 64-93)
Type:BH3 domain peptide
Mol. Mass.:3415.75
Organism:Mus musculus (Mouse)
Description:n/a
Residue:30
Sequence:
PNSILGQVGRQLALIGDDINRRYDTEFQNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.