BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Heat Shock Protein 90 (Hsp90)
Syringe Reactant:BDBM20740
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:09/29/09
 
ΔG°:-33.8± (kJ/mole)
pH:8±n/a
Log10Kb:5.88± 4.70
Temperature:303.15±n/a (K)
ΔH° :n/a
ΔHobs :-35.4±0.5 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.0053± (kJ/mole-K)
Comments:n/a
 
Citation Nilapwar, SWilliams, EFu, CProdromou, CPearl, LHWilliams, MALadbury, JE Structural-thermodynamic relationships of interactions in the N-terminal ATP-binding domain of Hsp90. J Mol Biol392:923-36 (2009) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Heat Shock Protein 90 (Hsp90)
Source:His-tagged N-terminal domain of yeast HSP90 was expressed and purified.
Purity:n/a
Prep. Method:Protein was purified by using nickel affinity column, and was subsequently concentrated by an (NH4)2SO4 precipitation and purified further using gel filtration chromatography.
Name:Heat Shock Protein 90 (Hsp90)
Synonyms:82 kDa heat shock protein | ATP-dependent molecular chaperone HSP82 | Heat shock protein Hsp90 heat-inducible isoform
Type:N-terminal domain
Mol. Mass.:23389.88
Organism:Saccharomyces cerevisiae (Baker s yeast)
Description:n/a
Residue:207
Sequence:
MASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEP
DLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQF
GVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDD
QLEYLEEKRIKEVIKRHSEFVAYPIQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20740
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM20740
Synonyms:Geldanamycin
TypeAntibiotic
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.