BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Heat Shock Protein 90 (Hsp90)
Syringe Reactant:BDBM31996
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:09/29/09
 
ΔG°:-7.63± (kcal/mole)
pH:8±n/a
Log10Kb:5.80± 4.30
Temperature:288.15±n/a (K)
ΔH° :n/a
ΔHobs :-4.88±0.0200 (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :0.0100± (kcal/mole-K)
Comments:n/a
 
Citation Nilapwar, SWilliams, EFu, CProdromou, CPearl, LHWilliams, MALadbury, JE Structural-thermodynamic relationships of interactions in the N-terminal ATP-binding domain of Hsp90. J Mol Biol392:923-36 (2009) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Heat Shock Protein 90 (Hsp90)
Source:His-tagged N-terminal domain of yeast HSP90 was expressed and purified.
Purity:n/a
Prep. Method:Protein was purified by using nickel affinity column, and was subsequently concentrated by an (NH4)2SO4 precipitation and purified further using gel filtration chromatography.
Name:Heat Shock Protein 90 (Hsp90)
Synonyms:82 kDa heat shock protein | ATP-dependent molecular chaperone HSP82 | Heat shock protein Hsp90 heat-inducible isoform
Type:N-terminal domain
Mol. Mass.:23389.88
Organism:Saccharomyces cerevisiae (Baker s yeast)
Description:n/a
Residue:207
Sequence:
MASETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEP
DLFIRITPKPEQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQF
GVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDEVNERIGRGTILRLFLKDD
QLEYLEEKRIKEVIKRHSEFVAYPIQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31996
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM31996
Synonyms:17-(dimethylaminoethylamino)-17-demethoxygeldanamycin | 17-DMAG | CHEMBL383824
Typen/a
Emp. Form.C32H48N4O8
Mol. Mass.616.7455
SMILESCO[C@H]1C[C@H](C)Cc2c(O)c(NC(=O)C(C)=CC=C[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@H]1O)cc(O)c2N=CCN(C)C |r,w:16.16,38.39,t:28|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.