BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Trypsin
Syringe Reactant:BDBM772
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/15/04
 
ΔG°:-26.6±0.300 (kJ/mole)
pH:8±n/a
Log10Kb:4.65± 3.30
Temperature:298.25±n/a (K)
ΔH° :-18.9±0.400 (kJ/mole)
ΔHobs :-18.9±0.400 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.0258±0.00200 (kJ/mole-K)
Comments:Data taken from Talhout, R.; Engberts, J. B. F. N. Eur. J. Biochem. 2001, 268, 1554-1560.
 
Citation Talhout, RVilla, AMark, AEEngberts, JB Understanding binding affinity: a combined isothermal titration calorimetry/molecular dynamics study of the binding of a series of hydrophobically modified benzamidinium chloride inhibitors to trypsin. J Am Chem Soc125:10570-9 (2003) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Trypsin
Source:no
Purity:n/a
Prep. Method:n/a
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM772
Source:Synthesized
Purity:n/a
Prep. Method:n/a
NameBDBM772
Synonyms:Benzamidine | CHEMBL79897 | [amino(phenyl)methylidene]azanium | benzamidine deriv. | benzamidinium chloride
Typen/a
Emp. Form.C7H9N2
Mol. Mass.121.1592
SMILESNC(=[NH2+])c1ccccc1
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.