BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HIV-1 Protease C Subtype Mutant (V82F/I84V)
Syringe Reactant:BDBM580
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/22/04
 
ΔG°:-53.9± (kJ/mole)
pH:5±n/a
Log10Kb:9.48± 7.96
Temperature:298.15±n/a (K)
ΔH° :-25.1± (kJ/mole)
ΔHobs :-25.1± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.0968± (kJ/mole-K)
Comments:In displacement titration, inhibitors were injected into the calorimetric cell containing the protein prebound to a weak inhibitor acetylpepstatin.
 
Citation Velazquez-Campoy, AVega, SFreire, E Amplification of the effects of drug resistance mutations by background polymorphisms in HIV-1 protease from African subtypes. Biochemistry41:8613-9 (2002) [PubMed]
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
HIV-1 Protease C Subtype Mutant (V82F/I84V)
Source:Plasmid-encoded HIV-1 protease was expressed in E. coli cells.
Purity:99%
Prep. Method:HIV-1 protease was purified and refolded from E. coli inclusion bodies.
Name:HIV-1 Protease C Subtype Mutant (V82F/I84V)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease C Subtype Mutant (V82F/I84V) chain A
Synonyms:HIV-1 Protease C Subtype Mutant (V82F/I84V) chain B | HIV-1 Protease Mutant (Q7K/M36I/S37N/R41K/H69K/V82F/I84V/L89M)
Type:Enzyme Subunit
Mol. Mass.:10806.78
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWKRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPFNVIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease C Subtype Mutant (V82F/I84V) chain A
Synonyms:HIV-1 Protease C Subtype Mutant (V82F/I84V) chain B | HIV-1 Protease Mutant (Q7K/M36I/S37N/R41K/H69K/V82F/I84V/L89M)
Type:Enzyme Subunit
Mol. Mass.:10806.78
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWKRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPFNVIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM580
Source:From Dr. Kiso, Department of Medicinal Chemistry, Kyoto Pharmaceutical University, Kyoto, Japan).
Purity:n/a
Prep. Method:were used without further purification
NameBDBM580
Synonyms:(4R)-3-[(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylphenyl)formamido]-4-phenylbutanoyl]-5,5-dimethyl-N-[(2-methylphenyl)methyl]-1,3-thiazolidine-4-carboxamide | AG1776 | JE-2147 | KNI-764
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.