BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:HIV-1 Protease B Subtype
Syringe Reactant:BDBM580
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:06/22/04
 
ΔG°:-62.3± (kJ/mole)
pH:5±n/a
Log10Kb:11.0± 9.62
Temperature:298.15±n/a (K)
ΔH° :-33.4± (kJ/mole)
ΔHobs :-33.4± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:not known
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.0968± (kJ/mole-K)
Comments:In displacement titration, inhibitors were injected into the calorimetric cell containing the protein prebound to a weak inhibitor acetylpepstatin.
 
Citation Velazquez-Campoy, AVega, SFreire, E Amplification of the effects of drug resistance mutations by background polymorphisms in HIV-1 protease from African subtypes. Biochemistry41:8613-9 (2002) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
HIV-1 Protease B Subtype
Source:Plasmid-encoded HIV-1 protease was expressed in E. coli cells.
Purity:99%
Prep. Method:HIV-1 protease was purified and refolded from E. coli inclusion bodies.
Name:HIV-1 Protease B Subtype
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (Q7K) chain A | HIV-1 Protease (Q7K) chain B | HIV-1 Protease B Subtype chain A | HIV-1 Protease B Subtype chain B | HIV-1 Protease Mutant (Q7K)
Type:Enzyme Subunit
Mol. Mass.:10782.21
Organism:Human immunodeficiency virus type 1
Description:All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:99
Sequence:
PQVTLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Protease chain A
Synonyms:HIV-1 Protease (Q7K) chain A | HIV-1 Protease (Q7K) chain B | HIV-1 Protease B Subtype chain A | HIV-1 Protease B Subtype chain B | HIV-1 Protease Mutant (Q7K)
Type:Enzyme Subunit
Mol. Mass.:10782.21
Organism:Human immunodeficiency virus type 1
Description:All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:99
Sequence:
PQVTLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM580
Source:From Dr. Kiso, Department of Medicinal Chemistry, Kyoto Pharmaceutical University, Kyoto, Japan).
Purity:n/a
Prep. Method:were used without further purification
NameBDBM580
Synonyms:(4R)-3-[(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylphenyl)formamido]-4-phenylbutanoyl]-5,5-dimethyl-N-[(2-methylphenyl)methyl]-1,3-thiazolidine-4-carboxamide | AG1776 | JE-2147 | KNI-764
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.