BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Alpha-fucosidase
Syringe Reactant:BDBM50065258
Meas. Tech.:Enzyme Inhibition
Entry Date:02/14/12
 
ΔG°:-44.8±0.400 (kJ/mole)
pH:6±0
Log10Kb:n/a
Temperature:37±0 (K)
ΔH° :-42.7±0.400 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.006±0.00100 (kJ/mole-K)
Comments:n/a
 
Citation Lammerts van Bueren, APopat, SDLin, CHDavies, GJ Structural and thermodynamic analyses of α-L-fucosidase inhibitors. Chembiochem11:1971-4 (2010) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info
 
Alpha-fucosidase
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Alpha-fucosidase
Synonyms:n/a
Type:Protein
Mol. Mass.:49785.16
Organism:Bacteroides thetaiotaomicron
Description:Q8ABG8
Residue:461
Sequence:
MKHIAFLSVKWMSVGLGMLSLLLSVASCGDKEYGDAMNEAQLMNDIEVNVGSSLPLAVGM
DFVLDYKPVPENVTNPEITLTSSDENVVSVSQDGRVTAKMIGKAYINLSQSTAFETLKTI
EVQVMPVATAIELENVELFEGTNKKVIVNVTPSDGYNVFDWKSDNEEVATVADDGTITGK
KPGTANISVSSQDGSQLTATAVVTVKEVIPIDKITLSEPGYDMMIGDKTLINCLLEPIDA
SVGLLSWSTTNDRVATVDADGLVTAVGAGEAEIIAQDPLSGLSASIAVKVVGEGVVSLSL
SYVRNQDELKALGWGFGQTPASVNFDAEGMTVNMSLQSNSKYRADLKMASNDRPVVLNIG
TYRYLAFRMDVPGNGSLKLDTNKGDYGNNPTGVLAEDSQVIYYDLQAKPYFPTDAPSDKL
TTFQLKIADVTVQPYSYKVYWVRTFKTLEDLKVYVEKENNK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065258
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM50065258
Synonyms:(2S,3R,4S,5R)-2-Methyl-piperidine-3,4,5-triol | (2S,3R,4S,5R)-2-methylpiperidine-3,4,5-triol | CHEMBL314772 | Fucosidase Inhibitor, 3
TypeSmall organic molecule
Emp. Form.C6H13NO3
Mol. Mass.147.1723
SMILESC[C@@H]1NC[C@@H](O)[C@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.