BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Methyl-accepting chemotaxis protein (McpS)
Syringe Reactant:BDBM26109
Meas. Tech.:Enzyme Inhibition
Entry Date:10/03/12
 
ΔG°:-22.7± (kJ/mole)
pH:n/a
Log10Kb:4.04± 4.04
Temperature:293.15±0 (K)
ΔH° :-33±0 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.04± (kJ/mole-K)
Comments:n/a
 
Citation Lacal, JAlfonso, CLiu, XParales, REMorel, BConejero-Lara, FRivas, GDuque, ERamos, JLKrell, T Identification of a chemoreceptor for tricarboxylic acid cycle intermediates: differential chemotactic response towards receptor ligands. J Biol Chem285:23126-36 (2010) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info
 
Methyl-accepting chemotaxis protein (McpS)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Methyl-accepting chemotaxis protein (McpS)
Synonyms:n/a
Type:Protein
Mol. Mass.:58698.14
Organism:Pseudomonas putida (Arthrobacter siderocapsulatus)
Description:Q9Z429
Residue:538
Sequence:
MQQFTIRTRLLMLVGAMFIGFITIELMGFSALQRGVASLNTVYLDRVVPLRDLKTIADLY
AVKIVDSSHKARSGRMTYAQAEQEVKDAGRQIDMLWHAYQKTKKIDEEQRSVDALAKLVD
EAQDPIERLKGILERGDKAALDTFVENEMYPLIDPLSEGLSHLTQIQVEESKRAYDAAVV
LYDSSRTMLALLLLGILICGGVFATRLIRSIIHPLTTLKDAAARVALGDLSQSIQVSGRN
EVTDVQQSVQAMQANLRNTLQDIQGSAAQLAAAAEELQTATESTAQGIHRQNDEMQMAAT
AVTEMSAAVDEVADNANRTSNASHEAMDLADGGRKQVMLTRETIDRLSGKLNETTRTVFR
LAEEASNIGRVLDVIRAIAEQTKLLALNAAIEAAHAGEAGRGFAVVADEVRNLAQRTQTS
TQEIERMISAIQSVTQEGVRDVQQSCEFAARSQTMSSEADQALTLIAERITEINGMNLVI
ASAAEEQAQVAREVDRNLVAISDISEQSTAGVQQTSEASEELARLAANLNNLVNRFSM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26109
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM26109
Synonyms:Butyrate | butanoic acid | butanoic acid, 4
TypeSmall organic molecule
Emp. Form.C4H8O2
Mol. Mass.88.1051
SMILESCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.