BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Enoyl-ACP Reductase (FabI) Mutant (F203L)
Syringe Reactant:BDBM3911
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:04/13/05
 
ΔG°:-35.1± (kJ/mole)
pH:7.5±n/a
Log10Kb:9.13± 8.15
Temperature:298.15±n/a (K)
ΔH° :-73.2±2.5 (kJ/mole)
ΔHobs :-73.2±2.5 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :-1.38±0.46 (kJ/mole)
Stoich. Param.:0.45
ΔS° : -0.128± (kJ/mole-K)
Comments:n/a
 
Citation Protasevich, IIBrouillette, CGSnow, MEDunham, SRubin, JRGogliotti, RSiegel, K Role of inhibitor aliphatic chain in the thermodynamics of inhibitor binding to Escherichia coli enoyl-ACP reductase and the Phe203Leu mutant: a proposed mechanism for drug resistance. Biochemistry43:13380-9 (2004) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Enoyl-ACP Reductase (FabI) Mutant (F203L)
Source:The His-tagged FabI (F203L) was expressed and purified from E. coli
Purity:Purity was not lower than 95%
Prep. Method:The calorimetric titration of FabI(F203L) was conducted in the presence of 0.5 mM NAD+.
Name:Enoyl-ACP Reductase (FabI) Mutant (F203L)
Synonyms:n/a
Type:Binary complex with a cofactor
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Enoyl-ACP Reductase (FabI) Mutant (F203L)
Synonyms:NADPH-dependent enoyl-ACP reductase
Type:Enzyme Subunit
Mol. Mass.:27827.10
Organism:Escherichia coli
Description:n/a
Residue:262
Sequence:
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDLRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
NameBDBM3909
Synonyms:NAD+
TypeNucleoside or nucleotide
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM3911
Source:Organic Synthesis
Purity:n/a
Prep. Method:n/a
NameBDBM3911
Synonyms:2-(2-hydroxyphenoxy)-5-methylphenol | 5-methyl-2-(2-hydroxyphenoxy)phenol | PD200828
TypeSmall organic molecule
Emp. Form.C13H12O3
Mol. Mass.216.2326
SMILESCc1ccc(Oc2ccccc2O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.