BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Purine nucleoside phosphorylase
Syringe Reactant:BDBM92922
Meas. Tech.:Enzyme Inhibition
Entry Date:03/18/13
 
ΔG°:-55.7±2 (kJ/mole)
pH:7.4±0
Log10Kb:n/a
Temperature:298.15±0 (K)
ΔH° :n/a
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :n/a
Comments:n/a
 
Citation Edwards, AAMason, JMClinch, KTyler, PCEvans, GBSchramm, VL Altered enthalpy-entropy compensation in picomolar transition state analogues of human purine nucleoside phosphorylase. Biochemistry48:5226-38 (2009) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Purine nucleoside phosphorylase
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Purine nucleoside phosphorylase
Synonyms:Inosine phosphorylase | Inosine-guanosine phosphorylase | Purine nucleoside phosphorylase (PNPase)
Type:Enzyme
Mol. Mass.:32119.53
Organism:Homo sapiens (Human)
Description:n/a
Residue:289
Sequence:
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRST
VPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGL
NPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ
MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92922
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM92922
Synonyms:Immucillins, 3
TypeSmall molecule
Emp. Form.C12H18N4O4
Mol. Mass.282.2957
SMILESOCC(CO)NC(CO)Cc1c[nH]c2c1nc[nH]c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.