BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:cAMP-activated global transcriptional regulator CRP
Syringe Reactant:BDBM10851
Meas. Tech.:Enzyme Inhibition
Entry Date:12/12/13
 
ΔG°:-25.5±0.420 (kJ/mole)
pH:7.8±0
Log10Kb:4.56± n/a
Temperature:298.15±0 (K)
ΔH° :2.90±0.840 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.098±0.00420 (kJ/mole-K)
Comments:CAP V132A second cAMP binding site
 
Citation Rodgers, TLTownsend, PDBurnell, DJones, MLRichards, SAMcLeish, TCPohl, EWilson, MRCann, MJ Modulation of global low-frequency motions underlies allosteric regulation: demonstration in CRP/FNR family transcription factors. PLoS Biol11:0 (2013) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
cAMP-activated global transcriptional regulator CRP
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:cAMP-activated global transcriptional regulator CRP
Synonyms:n/a
Type:n/a
Mol. Mass.:23514.00
Organism:Escherichia coli
Description:n/a
Residue:209
Sequence:
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMI
LSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQM
ARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSR
ETVGRILKMLEDQNLISAHGKTIVVYGTR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10851
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM10851
Synonyms:(4aR,6R,7R,7aS)-6-(6-amino-9H-purin-9-yl)-2,7-dihydroxy-hexahydro-1,3,5,2-furo[3,2-d][1,3,2]dioxaphosphinin-2-one | (4aR,6R,7R,7aS)-6-(6-amino-9H-purin-9-yl)tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinine-2,7-diol 2-oxide | ADENOSINE-3 ,5 -CYCLIC-MONOPHOSPHATE | Cyclic adenosine monophosphate | cAMP | cid_23902375
TypeSmall organic molecule
Emp. Form.C10H12N5O6P
Mol. Mass.329.2059
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@@H]2COP(O)(=O)O[C@H]2[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.