BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:MAP kinase ERK2
Syringe Reactant:BDBM103302
Meas. Tech.:Enzyme Inhibition
Entry Date:10/22/14
 
ΔG°:-38.0± (kJ/mole)
pH:7.5±0
Log10Kb:6.55± n/a
Temperature:303.15±0 (K)
ΔH° :-128±2 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.2968±0 (kJ/mole-K)
Comments:n/a
 
Citation Chaikuad, ATacconi, EMZimmer, JLiang, YGray, NSTarsounas, MKnapp, S A unique inhibitor binding site in ER K1/2 is associated with slow binding kinetics Nat Chem Biol10:853-860 (2014) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
MAP kinase ERK2
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Dual specificity mitogen-activated protein kinase kinase 1/Mitogen-activated protein kinase 1/RAF proto-oncogene serine/threonine-protein kinase
Synonyms:ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | p42-MAPK
Type:Ser/Thr Protein Kinase
Mol. Mass.:41392.76
Organism:Homo sapiens (Human)
Description:P28482
Residue:360
Sequence:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM103302
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM103302
Synonyms:SCH772984 | US8546404, 6
TypeSmall organic molecule
Emp. Form.C33H33N9O2
Mol. Mass.587.6742
SMILESO=C(CN1CC[C@@H](C1)C(=O)Nc1ccc2[nH]nc(-c3ccncc3)c2c1)N1CCN(CC1)c1ccc(cc1)-c1ncccn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.