BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Histone deacetylase 8 (HDAC8)
Syringe Reactant:BDBM152692
Meas. Tech.:Enzyme Inhibition
Entry Date:09/14/15
 
ΔG°:-31±2 (kJ/mole)
pH:7.5±0
Log10Kb:5.62± n/a
Temperature:25±0 (K)
ΔH° :-18.9± (kJ/mole)
ΔHobs :-19±1 (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.042±0.00300 (kJ/mole-K)
Comments:n/a
 
Citation Singh, RKSuzuki, TMandal, TBalsubramanian, NHaldar, MMueller, DJStrode, JACook, GMallik, SSrivastava, DK Thermodynamics of binding of structurally similar ligands to histone deacetylase 8 sheds light on challenges in the rational design of potent and isozyme-selective inhibitors of the enzyme. Biochemistry53:7445-58 (2014) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Histone deacetylase 8 (HDAC8)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM152692
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM152692
Synonyms:Thiol-SAHA (t-SAHA)
TypeSmall organic molecule
Emp. Form.C13H19NOS
Mol. Mass.237.361
SMILESSCCCCCCC(=O)Nc1ccccc1
Structure

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.