BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Intestinal fatty acid-binding protein (hIFABP)
Syringe Reactant:BDBM60927
Meas. Tech.:Enzyme Inhibition
Entry Date:10/05/15
 
ΔG°:-29.1±0.630 (kJ/mole)
pH:8±0
Log10Kb:4.90± n/a
Temperature:310.15±0 (K)
ΔH° :-15.3±1.60 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.0442±0.00710 (kJ/mole-K)
Comments:n/a
 
Citation Patil, RLaguerre, AWielens, JHeadey, SJWilliams, MLHughes, MLMohanty, BPorter, CJScanlon, MJ Characterization of two distinct modes of drug binding to human intestinal fatty acid binding protein. ACS Chem Biol9:2526-34 (2014) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Intestinal fatty acid-binding protein (hIFABP)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Intestinal fatty acid-binding protein (hIFABP)
Synonyms:FABPI | Fatty acid binding protein intestinal | Fatty acid-binding protein, intestinal | I-FABP
Type:Protein
Mol. Mass.:15207.56
Organism:Homo sapiens (Human)
Description:n/a
Residue:132
Sequence:
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60927
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM60927
Synonyms:1-anilinonaphthalene-8-sulfonic acid | 8-Anilino-1-naphthalenesulfonic acid | ANS | Anilinonaphthalene-8-sulfonic acid (ANS) | BDBM50126831
Typen/a
Emp. Form.C16H13NO3S
Mol. Mass.299.344
SMILESOS(=O)(=O)c1cccc2cccc(Nc3ccccc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.