BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Leucyl-tRNA synthetase (LeuRS)
Syringe Reactant:BDBM163674
Meas. Tech.:Enzyme Inhibition
Entry Date:02/16/16
 
ΔG°:-35±1 (kJ/mole)
pH:8±0
Log10Kb:6.13± n/a
Temperature:298.15±0 (K)
ΔH° :-4.20±0.800 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.1±0.00700 (kJ/mole-K)
Comments:n/a
 
Citation Zhao, HPalencia, ASeiradake, EGhaemi, ZCusack, SLuthey-Schulten, ZMartinis, S Analysis of the Resistance Mechanism of a Benzoxaborole Inhibitor Reveals Insight into the Leucyl-tRNA Synthetase Editing Mechanism. ACS Chem Biol10:2277-85 (2015) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info
 
Leucyl-tRNA synthetase (LeuRS)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Leucyl-tRNA synthetase (LeuRS)
Synonyms:n/a
Type:Protein
Mol. Mass.:125397.83
Organism:Candida albicans (Ascomycetes)
Description:C4YL05
Residue:1097
Sequence:
MSGPVTFEKTFRRDALIDIEKKYQKVWAEEKVFEVDAPTFEECPIEDVEQVQEAHPKFFA
TMAYPYMNGVLHAGHAFTLSKVEFATGFQRMNGKRALFPLGFHCTGMPIKAAADKIKREV
ELFGSDFSKAPIDDEDAVESQQPAKTETKREDVTKFSSKKSKAAAKQGRAKFQYEIMMQL
GIPREEVAKFANTDYWLEFFPPLCQKDVTAFGARVDWRRSMITTDANPYYDAFVRWQINR
LRDVGKIKFGERYTIYSEKDGQACLDHDRQSGEGVGPQEYVGIKIRLTDVAPQAQELFKK
ENLDVKENKVYLVAATLRPETMYGQTCCFVSPKIDYGVFDAGNGDYFITTERAFKNMSFQ
NLTPKRGYYKPLFIINGKTLIGSRIDAPYAVNKNLRVLPMETVLATKGTGVVTCVPSDSP
DDFVTTRDLANKPEYYGIEKDWVQTDIVPIVHTEKYGDKCAEFLVNDLKIQSPKDSVQLA
NAKELAYKEGFYNGTMLIGKYKGDKVEDAKPKVKQDLIDEGLAFVYNEPESQVISRSGDD
CCVSLEDQWYIDYGEEAWLGEALECLKNMETYSKETRHGFEGVLAWMKNWAVTRKFGLGT
KLPWDPQYLVESLSDSTVYMAYYTIDRFLHSDYYGKKAGKFDIKPEQMTDEVFDYIFTRR
DDVETDIPKEQLKEMRREFEYFYPLDVRVSGKDLIPNHLTFFIYTHVALFPKRFWPRGVR
ANGHLLLNNAKMSKSTGNFMTLEQIIEKFGADASRIAMADAGDTVEDANFDEANANAAIL
RLTTLKDWCEEEVKNQDKLRTGDYDSFFDAAFENEMNDLIEKTYQQYTLSNYKQALKSGL
FDFQIARDIYRESVNTTGIGMHKDLVLKYIEYQALMLAPIAPHFAEYLYREVLGKNGSVQ
TSKFPRASKPVSKAILDASEYVRSLTRSIREAEGQALKKKKGKSDVDGSKPTSLTVLVSN
TFPEWQDNYIELVRELFEQNKLDDNNVIRQKVGKDMKRGMPYIHQIKTRLATEDADTVFN
RKLTFDEIDTLKNVVEIVKNAPYSLKVEKLEILSFNNGETKGKNIISGEDNIELNFKGKI
MENAVPGEPGIFIKNVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM163674
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM163674
Synonyms:AN2690-AMP
TypeSmall organic molecule
Emp. Form.C18H18BFN5O4
Mol. Mass.398.177
SMILESCC[C@H]1O[C@H]([C@H]2O[B-]3(OCc4cc(F)ccc34)OC12)n1cnc2c(N)ncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.