BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Serine/threonine-protein kinase Aurora-B
Syringe Reactant:BDBM189380
Meas. Tech.:Enzyme Inhibition
Entry Date:08/03/16
 
ΔG°:-33±5.40 (kJ/mole)
pH:8±0
Log10Kb:5.78± n/a
Temperature:298.15±0 (K)
ΔH° :-58.2±5.40 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.0846±0.00200 (kJ/mole-K)
Comments:n/a
 
Citation Karthigeyan, DSurabhi, SMizar, PSoumik, SBanerjee, ASinha, SHDasgupta, DNarayana, CKundu, TK A Dual Non-ATP Analogue Inhibitor of Aurora Kinases A and B, Derived from Resorcinol with a Mixed Mode of Inhibition. Chem Biol Drug Des87:958-67 (2016) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Serine/threonine-protein kinase Aurora-B
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Aurora kinase A/B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM189380
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM189380
Synonyms:5-methyl-4-(2-thiazolylazo)resorcinol | PTK66
TypeSmall organic molecule
Emp. Form.C10H9N3O2S
Mol. Mass.235.262
SMILESCc1cc(O)cc(O)c1\N=N\c1nccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.