BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:3-phosphoinositide dependent protein kinase-1
Syringe Reactant:BDBM50433916
Meas. Tech.:Enzyme Inhibition
Entry Date:11/02/16
 
ΔG°:-35.0± (kJ/mole)
pH:n/a
Log10Kb:5.90± 4.30
Temperature:310±0 (K)
ΔH° :-5.02±0.300 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.0971±0 (kJ/mole-K)
Comments:n/a
 
Citation Schulze, JOSaladino, GBusschots, KNeimanis, SS, EOdadzic, DZeuzem, SHindie, VHerbrand, AKLisa, MNAlzari, PMGervasio, FLBiondi, RM Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase. Cell Chem Biol23:1193-1205 (2016) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
3-phosphoinositide dependent protein kinase-1
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:3-phosphoinositide dependent protein kinase-1
Synonyms:3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) | 3-phosphoinositide-dependent protein kinase 1 | 3-phosphoinositide-dependent protein kinase 1 (PDK) | 3-phosphoinositide-dependent protein kinase 1 (PDK-1) | 3-phosphoinositide-dependent protein kinase 1 (PDK1)(Δ1-50) | Isoform 2 of 3-phosphoinositide-dependent protein kinase 1 | PDK1 | PDPK1 | Phosphoinositide-dependent protein kinase 1 (PDK1) | Pyruvate dehydrogenase kinase isoenzyme 1 (PDK1) | hPDK1
Type:Enzyme
Mol. Mass.:63157.65
Organism:Homo sapiens (Human)
Description:O15530
Residue:556
Sequence:
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433916
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM50433916
Synonyms:PS653 ('1,6-dihydrodibenzo[c,d,g]indazol-6-one) | SP-600125
TypeSmall organic molecule
Emp. Form.C14H8N2O
Mol. Mass.220.2261
SMILESO=C1c2ccccc2-c2[nH]nc3cccc1c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.