BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1)
Syringe Reactant:BDBM213231
Meas. Tech.:Enzyme Inhibition
Entry Date:02/14/17
 
ΔG°:-29.2± (kJ/mole)
pH:7.5±0
Log10Kb:5.11± n/a
Temperature:298.15±0 (K)
ΔH° :-76.6±0 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : -0.159±0 (kJ/mole-K)
Comments:n/a
 
Citation Gosein, VMiller, GJ Roles of phosphate recognition in inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) substrate binding and activation. J Biol Chem288:26908-13 (2013) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data
 
Inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:50507.86
Organism:Arabidopsis thaliana (Mouse-ear cress)
Description:Q93YN9
Residue:451
Sequence:
MEMILEEKDASDWIYRGEGGANLVLAYAGSSPLFVGKVIRIQKARRNDKAIKNANGVVSV
LTSDEQHLWRENNELISSPNKEVLEQRYVKNVIIPLLGPKHVDAGVRVSVSKEFLECVDK
KVTKQRPLWRVNAANVDTSHDSALILNDHSLFSQGISSGGDCISVEIKPKCGFLPTSRFI
GKENMLKTSVSRFKMHQLLKLEYNEISEESEYDPLDLFSGSKESVLEAIKALYSTPQNNF
RVFLNGSLILGGSGESTGRTSPEIGYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGV
LDRLLEIQKLDKLDIEGAIHSYYDLINQPCPICKEGKPLEAELSLHALPLDESLKIVKEY
LIAATAKDCSIMISFQSRNAWDSEPSGDYVSLKPTNQTFDYKVHFIDLSLKPLKRMESYY
KLDKKIISFYNRKQKAENTAEQIGNSKPSHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM213231
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM213231
Synonyms:3,4,5,6-Inositol tetrakisphosphate (3,4,5,6-IP4)
TypeSmall organic molecule
Emp. Form.C6H8O18P4
Mol. Mass.492.0164
SMILESO[C@H]1[C@@H](O)[C@H](OP([O-])([O-])=O)[C@@H](OP([O-])([O-])=O)[C@H](OP([O-])([O-])=O)[C@H]1OP([O-])([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.