BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Caseinolytic protein C1 (ClpC1 NTD F80A)
Syringe Reactant:BDBM213240
Meas. Tech.:Enzyme Inhibition
Entry Date:02/21/17
 
ΔG°:-32.5± (kJ/mole)
pH:7.5±0
Log10Kb:5.69± n/a
Temperature:298.15±0 (K)
ΔH° :-25.3±0.452 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° : 0.024±0 (kJ/mole-K)
Comments:n/a
 
Citation Vasudevan, DRao, SPNoble, CG Structural basis of mycobacterial inhibition by cyclomarin A J Biol Chem288:30883-91 (2013) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Caseinolytic protein C1 (ClpC1 NTD F80A)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Caseinolytic protein C1 (ClpC1 NTD F80A)
Synonyms:n/a
Type:Protein
Mol. Mass.:15906.14
Organism:Mycobacterium tuberculosis
Description:M. tuberculosis ClpC1 N-terminal domain mutant F80A
Residue:145
Sequence:
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR
SQVEEIIGQGQQAPSGHIPATPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA
AQVLVKLGAELTRVRQQVIQLLSGY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM213240
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM213240
Synonyms:Cyclomarin A1 (CymA1)
TypeSmall organic molecule
Emp. Form.C59H92N10O11
Mol. Mass.1117.4222
SMILES[#6]-[#8]-[#6@@H](-[#6@@H]-1-[#7]-[#6](=O)-[#6@H](-[#6])-[#7]-[#6](=O)-[#6@H](-[#6]-[#6@@H](-[#6])-[#6]-[#8])-[#7](-[#6])-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#6])-[#6])-[#7](-[#6])-[#6](=O)-[#6@@H](-[#7]-[#6]-1=O)-[#6](-[#6])-[#6])-[#6@H](-[#6])\[#6]=[#6](/[#6])-[#6])-[#6@H](-[#8])-c1cn(c2ccccc12)C([#6])([#6])[#6@@H](-[#8])-[#6]-[#7]-[#6]-[#6]-[#6]-[#7])-c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.