BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:LysP-related transporter STM2200 (STM2200)
Syringe Reactant:BDBM217367
Meas. Tech.:Enzyme Inhibition
Entry Date:03/17/17
 
Δ G ° :n/a
pH:5.9±0
Log10Kb:n/a
Temperature:323.65±1 (K)
ΔH° :210±40 (kJ/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :n/a
Comments:n/a
 
Citation Kaur, JOlkhova, EMalviya, VNGrell, EMichel, H A L-lysine transporter of high stereoselectivity of the amino acid-polyamine-organocation (APC) superfamily: production, functional characterization, and structure modeling. J Biol Chem289:1377-87 (2014) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info
 
LysP-related transporter STM2200 (STM2200)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:LysP-related transporter STM2200 (STM2200)
Synonyms:n/a
Type:Protein
Mol. Mass.:53691.96
Organism:Salmonella typhimurium
Description:Q8ZNK9
Residue:489
Sequence:
MGSKTKTTEAPALRRELKARHLTMIAIGGSIGTGLFVASGATISQAGPGGALFSYILIGL
MVYFLMTSLGELAAYMPVSGSFATYGQNYVEEGFGFALGWNYWYNWAVTIAVDLVAAQLV
MGWWFPDTPGWIWSALFLCVIFLLNYISVRGFGEAEYWFSLIKVATVIIFIIVGVAMIIG
IFKGVEPVGWSNWTTGDAPFAGGFAAMIGVAMIVGFSFQGTELIGIAAGESENPEKNIPR
AVRQVFWRILLFYVFAILIISLIIPYTDPNLLRNDVKDISVSPFTLVFQHAGLLSAAAIM
NAVILTAVLSAGNSGMYASTRMLYTLACDGKAPRIFAKLSRGGVPRNALYATTVIAGLCF
LTSMFGNQTVYLWLLNTSGMTGFIAWLGIAISHYRFRRGYVLQGYDVNDLPYRSGFFPLG
PIFAFVLCLIITLGQNYEAFLKDTIDWGGVAATYIGIPLFLLIWFGYKLIKGTHFVRYSE
MHFPERVKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM217367
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM217367
Synonyms:(2S)-2,6-diaminohexanoic acid | L-Lysine
TypeSmall organic molecule
Emp. Form.C6H14N2O2
Mol. Mass.146.1876
SMILESNCCCC[C@H](N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.